KEGG   Sulfolobus acidocaldarius SUSAZ: SUSAZ_01375Help
Entry
SUSAZ_01375       CDS       T02975                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sacs  Sulfolobus acidocaldarius SUSAZ
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sacs00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SUSAZ_01375
Enzymes [BR:sacs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SUSAZ_01375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(231906..232772)
Genome map
AA seq 288 aa AA seqDB search
MIVVVGSYNVDFLIKVRDFPSEGETVFSDGVYIDHGGKGSNQAVSASRLGGSVRLISAVG
NDEFGKRAIKFWEDERLDIAYVKIKNALTGSAYIVFDRKGRNFIVVNRGANALLNEEDLD
GCLNGDILLTQLEVNENIVKKALKEFPGVKILNPAPAVLNDKSLLEYVDILTPNEIEFKE
LTGTQDFNYGIDLLLKKVKRAVIVTLGEKGAYIGTRERRILIPTLTVDAIDTTGAGDVFN
ASLAVYLEKGYSLERAVRISNIISAYSTTRIGALGPRLSEVSELIEKE
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgatcgttgttgttggaagttataatgtggattttctaattaaggttagagatttccca
tcagagggagaaacagttttcagtgatggtgtctacatagatcacggagggaagggctca
aatcaagctgtatctgcgtcaagattaggtggaagcgttaggttaatctctgcagtgggt
aatgacgagttcggaaaaagggctataaaattttgggaggacgaaaggttagatattgcg
tatgtgaaaattaaaaacgcgttaacaggctctgcttacatagtctttgataggaaaggg
aggaacttcatagttgtgaatagaggagcaaatgctctcctcaatgaagaggacttagat
ggatgtttaaatggagatattttacttacacaattggaagtgaacgagaacattgttaag
aaagcattgaaggagttccccggtgttaaaatattaaatccagcccctgctgttcttaat
gacaagtccctgctcgaatacgttgatattttgacgccaaatgaaattgagtttaaggaa
ttgacaggcactcaagatttcaactacggaatagacttactcttaaagaaagttaagagg
gcagtaatagtaacgttaggtgaaaagggagcttacataggcacaagggagaggagaatt
ttaatccctacacttacagtagacgctattgacactacaggagctggtgatgtttttaat
gcatccctggcggtttaccttgagaagggctatagtttagagagggcggtgagaatctct
aacataatctcagcgtattcaactacaaggataggtgccttaggacccaggttgagcgag
gtgagtgaattaattgaaaaagagtga

DBGET integrated database retrieval system