KEGG   Sulfolobus acidocaldarius SUSAZ: SUSAZ_02495Help
Entry
SUSAZ_02495       CDS       T02975                                 

Definition
sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sacs  Sulfolobus acidocaldarius SUSAZ
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sacs00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SUSAZ_02495
Enzymes [BR:sacs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SUSAZ_02495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
421510..422373
Genome map
AA seq 287 aa AA seqDB search
MKPLHLSVGRINIDIIAKINKIPDIDEFETTDTLEILPGGAAVNYAVAINKFGHSIKILS
KIGKDSLVSYVLERIAEMGVGLDYVEETNLPQSMALIFLRDNGSISMVRKLGSSILLDKE
DIKKVFGLFDVIHFASISPDIVVRDPYAKLITYDPGPNSSKIPENFGNADIIYLNEREST
RVKIESLKARLIVIKMGSKGAKVISENEECYCEPYKVQTVLDTTGAGDVFDAAFNYAYMQ
GHSIEDTLRFAVTASALKVTRIGGINSPTREEVMNALNAYTPNTKCK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccacttcacttgtcagtaggtaggataaacattgatattatagctaagattaac
aaaatacctgatatcgatgagtttgaaacaacagacacactagaaattttaccaggtgga
gcagcagttaattacgctgtagctataaataaatttggtcacagtattaagattttatct
aagataggcaaagattcacttgtctcttatgtactagaaaggatagcagaaatgggagta
ggacttgattacgtagaggaaacaaacttaccacagagcatggcattaatatttttgaga
gataacggaagcatttcaatggtcaggaagctaggttcttcaattctccttgataaagag
gatataaagaaagtcttcgggttatttgatgttatacatttcgcttcaatttctccggat
atcgttgttagggatccttacgctaagcttataacttatgatccaggtccaaatagttca
aaaattcctgaaaattttgggaatgcagatataatatatttgaacgagagggagagcact
agggtcaagatagaaagtcttaaggcacgactgatcgtaataaaaatgggatcgaaggga
gctaaggtgatatcagaaaatgaagagtgttattgcgagccatataaagttcaaactgtt
ttggatacaactggtgctggagatgtttttgacgctgcatttaattatgcgtatatgcag
ggacactcaatagaggatactcttagattcgctgtaactgcctctgcattaaaagtaacg
agaataggagggataaattctccaactagagaggaagttatgaatgccttaaatgcttat
acaccaaatactaaatgtaaatga

DBGET integrated database retrieval system