KEGG   Sulfolobus acidocaldarius SUSAZ: SUSAZ_04835Help
Entry
SUSAZ_04835       CDS       T02975                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
sacs  Sulfolobus acidocaldarius SUSAZ
Brite
Enzymes [BR:sacs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     SUSAZ_04835
Transfer RNA biogenesis [BR:sacs03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    SUSAZ_04835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(794400..795770)
Genome map
AA seq 456 aa AA seqDB search
MISGVTIVSVMTHPHRCPHGKCIFCPGGVEYGTPQSYYGNEPTLMRAIENNYEPFYQVQS
RLRQYEANGHNPSKIELIIMGGTFLATPIDYQDWFVTQALEAMNRYPSSQKPGFTFLEDA
QLRNETASIRCVGLTVETKPDWSKEVHAKQMLRLGVTKVELGVQTVYDDLLTRSNRGHTV
KDSIEATKILKDNGFKVVYHMMLGLPGSDPDKDLESFKRIFSDPDFSPDMLKIYPTLVVE
TAPLAELWKRGLYKPYDTETLIELISEIYKLIPPWVRVMRVQRDIPATIIIDGNKKGNLR
ELVENRAKQKGIKINEIRHREVGIKWIHTGKLPTGEPKLKRYEYEASGGIEVFLSYEYDD
DTLVGYLRLRKPSNRDDVTIVRELHIYGPETPVGLWDDFSFQHKGYGGRLLAEAERISAE
EFDVKKILVLSGIGVREYYRKKGYHNEYPYVAKDLK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgatctccggagtaacaatagtgtcagtaatgacacatccccatagatgccctcatgga
aaatgtatattctgcccaggaggtgttgagtacggtacaccacagagctattatggaaat
gaacctacattgatgagggcaatagagaacaattatgaaccgttttaccaagtccaatct
cgcctcaggcaatatgaggctaatggtcacaacccaagcaagatcgaacttataatcatg
ggaggaacatttcttgctactcccatagattatcaagattggtttgttactcaagcccta
gaggctatgaatagatacccctctagccaaaaaccaggttttacgttcttagaggatgcg
caactgagaaacgagactgcctcaataagatgtgttggattaactgttgaaactaaacca
gactggagtaaagaggttcatgcgaagcaaatgcttagacttggggtaacaaaagttgaa
ttgggagttcaaacagtatacgacgatctgttgactcggagcaacaggggtcacacggtt
aaagactcaatagaagctactaaaattctaaaagacaatggatttaaagtagtatatcac
atgatgcttggcttgcccggtagtgaccctgataaggatctagagtctttcaagagaata
ttttctgatcccgatttttcaccagatatgttgaagatatatccaactctagtagtggag
actgccccattagctgaactgtggaagaggggtctttacaaaccctatgatactgaaaca
ctaattgaacttatttctgaaatctataagttgataccaccttgggtgagagtaatgaga
gtccagagagacataccggctaccattattattgatggtaataagaaagggaacctcaga
gaactagttgagaatagggcaaaacagaagggcattaaaatcaatgaaataagacacaga
gaagtgggaataaaatggatacatacaggaaagttacccactggtgaaccaaaattaaag
agatatgagtatgaagccagtggaggtatagaggtgttcttatcttacgaatatgacgac
gatacactggtgggctatctcaggttaagaaagccaagtaatagagatgacgtcactata
gtgagggagttacatatctacggaccagaaactccagtgggactttgggatgatttttcc
ttccaacataagggatatggaggaagactattagcagaggctgaaagaatatcagcagag
gaatttgatgtgaaaaagattctagtactttcagggattggtgttagagaatattacaga
aagaagggatatcacaacgaatatccttacgttgcaaaggatttaaaatga

DBGET integrated database retrieval system