KEGG   Stenotrophomonas acidaminiphila: AOT14_05220Help
Entry
AOT14_05220       CDS       T04107                                 

Gene name
fadI_2
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sacz  Stenotrophomonas acidaminiphila
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:sacz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AOT14_05220 (fadI_2)
   00630 Glyoxylate and dicarboxylate metabolism
    AOT14_05220 (fadI_2)
   00640 Propanoate metabolism
    AOT14_05220 (fadI_2)
   00650 Butanoate metabolism
    AOT14_05220 (fadI_2)
  Lipid metabolism
   00071 Fatty acid degradation
    AOT14_05220 (fadI_2)
   00072 Synthesis and degradation of ketone bodies
    AOT14_05220 (fadI_2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AOT14_05220 (fadI_2)
   00310 Lysine degradation
    AOT14_05220 (fadI_2)
   00380 Tryptophan metabolism
    AOT14_05220 (fadI_2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AOT14_05220 (fadI_2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AOT14_05220 (fadI_2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AOT14_05220 (fadI_2)
Enzymes [BR:sacz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AOT14_05220 (fadI_2)
Exosome [BR:sacz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AOT14_05220 (fadI_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
599443..600723
Genome map
AA seq 426 aa AA seqDB search
MTRFAGPVYVAAGLRTPFGRGGGPLSAYDAVSLSVPVVKAMAAQAEPDLLVWGTVIPNMG
WSNIARETWLDAKLSPTVPAFSVVLACSTSMTATFAAAGMLGGGTELTMVGGSEVMSRPQ
IALTADASKRLTDLFARDPAAALGALQALTPRDYLLPTKGWANRITGRTMGDHMEETAKA
WQVTREAQDDWALKSHQRAVAGWERGFFDDLVIPLPELARDANPRADTSPERLAALKPVF
DRDSGKGSLTAGNSSPITDGAAGCWVATKAGLARLPTGTPYARLVDYEVSAVDFHTEGLL
MAPAYGIPRLLARNRLSFADIGLWEIHEAFASQVLANVAAISDPEWVRTKAGVQAAMGDF
NWDRVNPNGGSVAIGHPFGATGARDLSQAVKELWAMPPGSRAIVSICADGGQGTVALLER
PWMGDQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgactcgttttgccggacccgtttacgtagccgctggccttcgaacccctttcggacga
ggtggaggcccgttgtcggcctatgacgccgtgtccctgtcggtccctgttgtaaaggcg
atggcggcccaggcggagccagatctgctcgtctggggaacagtgattccgaacatgggc
tggagcaacatcgcccgcgagacctggctggacgccaagctcagtcccacggtgccggcg
ttctcggtcgtcctggcctgctctaccagcatgacggccacgttcgcggcggcggggatg
ctgggcgggggaacggaactcacgatggtcggcgggtccgaagtcatgagccgccctcaa
atcgccctgacggcagatgcatctaagcggctcacggatctgtttgcgcgcgatcccgcg
gctgcacttggcgccctccaagcccttaccccacgcgactatctgctgcccaccaagggc
tgggcaaaccggatcaccggccggaccatgggcgaccatatggaggagacggccaaggct
tggcaggtcacacgcgaggcgcaggacgactgggcgctcaagagtcaccagcgcgccgtg
gcgggatgggagcgtggcttcttcgacgatctcgtgatcccgctgccggagctggcgcgc
gatgcgaatccccgggctgatacgtcgcccgaacggcttgccgcactcaagccggtcttt
gatcgcgacagtggaaaggggagcctgacggcgggcaatagctccccgatcaccgatggc
gctgccggctgctgggtcgccaccaaggccggactggcccgactccccacgggcacgccc
tacgcgcggctcgtggactacgaggtgtctgcggtggatttccataccgaaggtctgctc
atggcgccggcgtatgggatccctcgcctgctcgcccggaatcgactgagcttcgccgac
atcgggctctgggagatccacgaggccttcgcgtcccaggtcctagcgaacgtggcggct
atttccgacccggagtgggtgcgcacaaaggccggcgtccaggcggctatgggcgatttc
aattgggaccgtgtcaatcccaacggaggctcggtcgccattgggcatccgtttggcgcg
accggcgcgcgtgacctgagccaggcggtgaaggagctctgggccatgcctcctggctcg
cgcgcgatcgtcagcatttgcgccgacggcggtcagggcacggttgcactcctcgagcgc
ccatggatgggagatcagtaa

DBGET integrated database retrieval system