KEGG   Stenotrophomonas acidaminiphila: AOT14_13150Help
Entry
AOT14_13150       CDS       T04107                                 

Definition
(GenBank) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sacz  Stenotrophomonas acidaminiphila
Pathway
sacz00071  Fatty acid degradation
sacz00072  Synthesis and degradation of ketone bodies
sacz00280  Valine, leucine and isoleucine degradation
sacz00310  Lysine degradation
sacz00362  Benzoate degradation
sacz00380  Tryptophan metabolism
sacz00620  Pyruvate metabolism
sacz00630  Glyoxylate and dicarboxylate metabolism
sacz00640  Propanoate metabolism
sacz00650  Butanoate metabolism
sacz00900  Terpenoid backbone biosynthesis
sacz01100  Metabolic pathways
sacz01110  Biosynthesis of secondary metabolites
sacz01120  Microbial metabolism in diverse environments
sacz01130  Biosynthesis of antibiotics
sacz01200  Carbon metabolism
sacz01212  Fatty acid metabolism
sacz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sacz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AOT14_13150
   00630 Glyoxylate and dicarboxylate metabolism
    AOT14_13150
   00640 Propanoate metabolism
    AOT14_13150
   00650 Butanoate metabolism
    AOT14_13150
  Lipid metabolism
   00071 Fatty acid degradation
    AOT14_13150
   00072 Synthesis and degradation of ketone bodies
    AOT14_13150
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AOT14_13150
   00310 Lysine degradation
    AOT14_13150
   00380 Tryptophan metabolism
    AOT14_13150
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AOT14_13150
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AOT14_13150
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AOT14_13150
Enzymes [BR:sacz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AOT14_13150
Exosome [BR:sacz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AOT14_13150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALJ27718
UniProt: A0A0S1AY44
Position
complement(1482581..1483756)
Genome map
AA seq 391 aa AA seqDB search
MSDIVIAAAKRTAIGSFLGQFNGVPTPTLGATAIRAAMEQSGVAAADVSEVIMGCVLPAN
LGQAPARQASLAAGLPASTGCTTLNKVCGSGMKAIMLGHDLIKAGSASIVVAGGMESMSN
APHMIPNSRTGNRYGNFQAVDHMAWDGLTNPYDGQAMGVFAEGTVAKFGFTREEQDAYAI
ESVRRAQAAQAAGAFKDEIVPVKVATRKGEVEVDQDEQPGKSDIAKIPTLRPAFKKDGSV
TAASSSSISDGAAAVVLMDAGEAARRGVQPLARIVAHATFAQEPEWFTTAPIGAVRQVLD
KAGWQIGDVDLFEINEAFAVVAMAPIRELGIAHDKLNVNGGACALGHPIGASGARLVVTL
VNALRSRGLKRGIASLCIGGGEATAIAIELI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcgtcatcgccgccgcaaagcgcaccgccatcggctccttcctcggccag
ttcaacggcgtccccaccccgaccctcggcgccacggcgatccgtgcggccatggaacag
tccggcgtcgccgccgccgatgtttccgaagtgatcatgggctgcgtactgccggccaac
ctgggccaggcaccggcgcgccaggcgtcgctcgctgccggcctgcccgccagcaccggc
tgcaccacgctcaacaaggtgtgcggctcgggcatgaaagcgatcatgctggggcacgac
ctgatcaaggccggctcggccagcatcgtcgtcgccggcggcatggagtccatgtccaat
gcgccgcacatgatccccaactcgcgcaccggcaaccgctacggcaacttccaggcggtg
gaccacatggcctgggacggcctgaccaacccctacgacggccaggccatgggcgtgttc
gccgaaggcaccgtcgccaagttcggcttcacccgcgaagagcaggacgcctacgccatc
gagtcggtcaggcgcgcgcaggccgcgcaggccgcgggcgcgttcaaggatgagatcgtt
ccggtcaaggtcgccacccgcaagggcgaggtcgaggttgaccaggacgaacagccgggc
aagtccgacatcgccaagattccgaccctgaggccggccttcaagaaggatggcagcgtc
accgccgccagctcctccagcatctccgacggcgccgccgccgtggtgctgatggacgcc
ggcgaagccgcgcgtcgcggcgtgcagccgttggcccgcatcgtcgcccacgccaccttc
gcgcaggagccggagtggttcaccaccgcgccgatcggcgcggtcaggcaggtgctggac
aaggccggctggcagatcggcgacgtggatctgttcgagatcaacgaagccttcgcggtg
gtggcgatggctccgatccgcgagctgggcatcgcgcatgacaagctcaacgtcaacggt
ggcgcctgcgcgctgggccatccgatcggcgcttcgggcgcgcgcctggtggtcacgctg
gtcaacgcgttgcgcagccgtggcctcaagcgtggcatcgcctccctctgcatcggcggc
ggcgaagcaactgccatcgccatcgaattgatttga

DBGET integrated database retrieval system