KEGG   Staphylococcus aureus subsp. aureus ED98: SAAV_0343Help
Entry
SAAV_0343         CDS       T01124                                 

Definition
(RefSeq) phosphoglycerate mutase family protein
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sad  Staphylococcus aureus subsp. aureus ED98
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sad00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAAV_0343
   01230 Biosynthesis of amino acids
    SAAV_0343
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAAV_0343
  Energy metabolism
   00680 Methane metabolism
    SAAV_0343
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAAV_0343
Enzymes [BR:sad01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SAAV_0343
Exosome [BR:sad04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SAAV_0343
  Exosomal proteins of melanoma cells
   SAAV_0343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
381282..381863
Genome map
AA seq 193 aa AA seqDB search
MTIYLVRHGESKSNYDNKHFRSYFCGQLDVPLTDTGTKSADDLCDYFKEKQIKHVYVSDL
LRTQQTFEHIFPYDIASTTTPLLRERSLGVFEGEYKDEISANPKYEKYFNDPNFKDFRHS
FSQKAPEGESYEDVYQRVEHFMNHVVNEDTQKDDIVIVAHQVVIRCLMVYFNKVSREEAV
DLKVENCKPYIIE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgacgatttatttagttagacatggcgaatcaaaatcgaattatgataataaacatttt
cgatcttatttttgtggacaattagatgtgccgttaacggatactggcacaaaaagtgca
gacgatttatgtgattattttaaagagaaacagattaaacatgtatatgtttcagactta
ttaagaacacagcaaacgtttgaacatatttttccatatgacattgcatcaacgactacc
cctctattaagagaacgttcacttggcgtatttgagggtgaatataaagatgaaatcagt
gcgaatccgaaatatgaaaaatatttcaatgatccaaactttaaagactttcgtcatagt
ttttcacaaaaagcgcctgaaggagaaagttatgaagatgtatatcaacgcgtagaacat
tttatgaatcatgttgtcaatgaagatacacaaaaagatgatattgtcattgttgcacat
caagttgtcattcgttgtttgatggtttattttaacaaagtttcaagggaagaagctgtg
gatttaaaggtagaaaattgcaaaccatatatcattgaatag

DBGET integrated database retrieval system