KEGG   Staphylococcus aureus subsp. aureus ED98: SAAV_0740Help
Entry
SAAV_0740         CDS       T01124                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sad  Staphylococcus aureus subsp. aureus ED98
Pathway
sad00010  Glycolysis / Gluconeogenesis
sad00051  Fructose and mannose metabolism
sad00562  Inositol phosphate metabolism
sad01100  Metabolic pathways
sad01110  Biosynthesis of secondary metabolites
sad01120  Microbial metabolism in diverse environments
sad01130  Biosynthesis of antibiotics
sad01200  Carbon metabolism
sad01230  Biosynthesis of amino acids
Module
sad_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sad_M00002  Glycolysis, core module involving three-carbon compounds
sad_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sad00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAAV_0740 (tpiA)
   00051 Fructose and mannose metabolism
    SAAV_0740 (tpiA)
   00562 Inositol phosphate metabolism
    SAAV_0740 (tpiA)
Enzymes [BR:sad01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SAAV_0740 (tpiA)
Exosome [BR:sad04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SAAV_0740 (tpiA)
  Exosomal proteins of bladder cancer cells
   SAAV_0740 (tpiA)
  Exosomal proteins of melanoma cells
   SAAV_0740 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACY10660
Structure
PDB: 

Jmol
Position
794296..795057
Genome map
AA seq 253 aa AA seqDB search
MRTPIIAGNWKMNKTVQEAKDFVNALPTLPDSKEVESVICAPAIQLDALTTAVKEGKAQG
LEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFK
HGMTPIICVGETDEERESGKANDVVGEQVKKAVAGLSEDQLKSVVIAYEPIWAIGTGKSS
TSEDANEMCAFVRQTIADLSSKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASL
KVEDFVQLLEGAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaccaattatagctggtaactggaaaatgaacaaaacagtacaagaagcaaaa
gacttcgtcaatgcattaccaacattaccagattcaaaagaagtagaatcagtaatttgt
gcaccagcaattcaattagatgcattaactactgcagttaaagaaggaaaagcacaaggt
ttagaaatcggtgctcaaaatacgtatttcgaagataatggtgcgttcacaggtgaaacg
tctccagttgcattagcagatttaggcgttaaatacgttgttatcggtcattctgaacgt
cgtgaattattccacgaaacagatgaagaaattaacaaaaaagcgcacgctattttcaaa
catggaatgactccaattatttgtgttggtgaaacagacgaagagcgtgaaagtggtaaa
gctaacgatgttgtaggtgagcaagttaagaaagctgttgcaggtttatctgaagatcaa
cttaaatcagttgtaattgcttatgagccaatctgggcaatcggaactggtaaatcatca
acatctgaagatgcaaatgaaatgtgtgcatttgtacgtcaaactattgctgacttatca
agcaaagaagtatcagaagcaactcgtattcaatatggtggtagtgttaaacctaacaac
attaaagaatacatggcacaaactgatattgatggggcattagtaggtggcgcatcactt
aaagttgaagatttcgtacaattgttagaaggtgcaaaataa

DBGET integrated database retrieval system