KEGG   Staphylococcus aureus subsp. aureus ED98: SAAV_1171Help
Entry
SAAV_1171         CDS       T01124                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sad  Staphylococcus aureus subsp. aureus ED98
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sad00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SAAV_1171 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAAV_1171 (pyrB)
Enzymes [BR:sad01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SAAV_1171 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1192627..1193508
Genome map
AA seq 293 aa AA seqDB search
MNHLLSMEHLSTDQIYKLIQKASQFKSGERQLPNFEGKYVANLFFENSTRTKCSFEMAEL
KLGLKTISFETSTSSVSKGESLYDTCKTLESIGCDLLVIRHPFNNYYEKLANINIPIANA
GDGSGQHPTQSLLDLMTIYEEYGYFEGLNVLICGDIKNSRVARSNYHSLKALGANVMFNS
PNAWIDDSLEAPYVNIDDVIETVDIVMLLRIQHERHGLAEETRFAADDYHQKHGLNEVRY
NKLQEHAIVMHPAPVNRGVEIQSDLVEASKSRIFKQMENGVYLRMAVIDELLK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatttattatcaatggaacatttatctacagatcaaatatacaaacttatccaa
aaggcaagtcaatttaaatctggtgaacgtcaactaccaaactttgaagggaaatatgtc
gcaaatttattctttgaaaattctactcgaacaaaatgtagttttgaaatggcagaactt
aagctagggttaaaaacgattagctttgaaacatcaacatcatctgtttcaaaaggtgaa
tctttatatgacacatgtaaaactttagaaagtattggctgtgatttattagtcattaga
catccgtttaataactactatgaaaaattagcgaatattaacatcccaattgcgaatgct
ggtgatggtagtggacaacatccaacacaaagtttacttgatttaatgacgatatatgaa
gaatatggatattttgaaggcttgaatgtattgatttgtggagacattaaaaattcacgt
gtcgcacgtagtaattaccatagtttaaaagcattaggtgcaaacgtaatgtttaatagc
ccaaatgcttggattgatgattctttagaagcaccttatgtaaatatagatgatgttata
gaaacagtagatatagttatgttattaagaattcaacatgaaagacatgggcttgcagaa
gaaactagatttgcagcagatgattatcatcaaaagcatggcttaaatgaagtgcgctat
aacaaattacaagaacatgctattgttatgcatccggcacctgtgaatagaggagtagaa
atacaaagcgatttagtagaagcttcaaaatcaagaatttttaagcaaatggaaaatggc
gtttacttaagaatggcagtcattgatgaattattaaaatag

DBGET integrated database retrieval system