KEGG   Staphylococcus aureus subsp. aureus ED98: SAAV_1355Help
Entry
SAAV_1355         CDS       T01124                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sad  Staphylococcus aureus subsp. aureus ED98
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sad00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAAV_1355 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAAV_1355 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAAV_1355 (trpA)
Enzymes [BR:sad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SAAV_1355 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1390919..1391647
Genome map
AA seq 242 aa AA seqDB search
MTKLFIPYIMGNKDLIENATLLSENGADIIEIGVPFSDPVADGPVIMEAGQQAIKQGITI
DYIFNQLEKHGDQIKCNYVLMTYYNIICHYGEQAFFEKCRDTGVYGLIIPDLPYELSQRL
KQQFSHYGVKIISLVAMTTDDKRIKDIVSHAEGFIYTVTMNATTGQNGAFHPELKRKIES
IKAIANVPVVAGFGIRTPQHVADIKEVADGIVIGSEIVKRFKSNTREEIIRYLQSIQQTL
NN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgactaaattatttataccttatattatgggcaataaagatttgattgaaaatgcaaca
ttgttgagtgaaaatggtgcagatataattgaaattggtgtacctttctctgatccggtt
gctgatggtccagttatcatggaagcaggtcaacaagcgattaaacaaggcatcacgata
gattatattttcaatcaattagaaaaacatggtgatcaaattaagtgtaactatgtatta
atgacgtattataatattatttgtcattatggagaacaagcgttttttgaaaaatgtcga
gatactggtgtctacggcttaattattcctgatttaccatatgaattatcgcagcgttta
aaacaacaatttagtcactatggcgtcaaaatcatatcgttagttgcgatgactactgat
gacaaacgtataaaagatatcgtatctcatgcggaaggctttatttatactgtgacgatg
aatgcgacaacaggacaaaacggtgcgtttcatccagaattaaaacgaaaaattgagtca
attaaagcgatagccaatgtgccagttgtcgcaggatttggtataagaacaccacaacat
gttgcagatataaaagaggttgcagatggcatcgtcattggtagcgaaatcgttaagcga
tttaaatctaacacgcgtgaggaaatcattagatatttacaatctatccaacaaacattg
aataattaa

DBGET integrated database retrieval system