KEGG   Staphylococcus aureus subsp. aureus ED98: SAAV_2565Help
Entry
SAAV_2565         CDS       T01124                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sad  Staphylococcus aureus subsp. aureus ED98
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sad00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SAAV_2565 (galU)
   00052 Galactose metabolism
    SAAV_2565 (galU)
   00500 Starch and sucrose metabolism
    SAAV_2565 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SAAV_2565 (galU)
Enzymes [BR:sad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SAAV_2565 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2582141..2582923)
Genome map
AA seq 260 aa AA seqDB search
MLPILDKPTIQYIVEEAARAGIEDIIIVTGRHKRAIEDHFDSQKELEMVLKEKGKSELLE
KVQYSTELANIFYVRQKEQKGLGHAISSARQFIGNEPFAVLLGDDIVESEVPAVKQLIDV
YEETGHSVIGVQEVPEADTHRYGIIDPLTKNGRQYEVKKFVEKPAQGTAPSNLAIMGRYV
LTPEIFDYLKTQKEGAGNEIQLTDAIERMNNDNQVYAYDFEGERYDVGEKLGFVKTTIEY
ALKDDSMREELTRFIKALGL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcttcctatcttagataaacccacaatacaatatatcgttgaagaagctgcaagagct
ggaattgaagatattattatagtgacaggtcgccacaaacgcgcgattgaagatcatttt
gatagtcaaaaagaattagaaatggtgttaaaagaaaaaggtaaatctgaattactagaa
aaagttcaatactcgacagaacttgcgaatattttttatgtaagacagaaagaacaaaaa
ggtttagggcatgcgattagttctgcgcgtcaatttatcggcaatgaaccatttgcggta
ttattaggtgacgatattgttgaatctgaagtgccagcagtgaaacagttgattgacgtt
tatgaagaaacggggcactcagttataggtgtccaagaagttccggaagcagatactcat
cgttatggaattattgatccattaactaaaaatggacgtcagtatgaagtgaaaaagttt
gttgaaaagccagcacaaggtacggcaccatcaaacctagctattatgggccgatatgta
ttaacgcctgaaattttcgattatttaaaaacgcaaaaagaaggcgcaggtaacgaaatt
cagttaacagatgcgattgagcgtatgaacaatgataatcaagtgtatgcatatgacttc
gaaggcgaacgttatgacgttggagaaaaattaggatttgtcaaaacaacaatagaatat
gcgttgaaagatgacagtatgcgagaagaattaacacgatttattaaagcattaggttta
taa

DBGET integrated database retrieval system