KEGG   Staphylococcus aureus subsp. aureus ED98: SAAV_2675Help
Entry
SAAV_2675         CDS       T01124                                 

Definition
(GenBank) acetyl-CoA synthetase, putative
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sad  Staphylococcus aureus subsp. aureus ED98
Pathway
sad00010  Glycolysis / Gluconeogenesis
sad00620  Pyruvate metabolism
sad00640  Propanoate metabolism
sad00680  Methane metabolism
sad01100  Metabolic pathways
sad01110  Biosynthesis of secondary metabolites
sad01120  Microbial metabolism in diverse environments
sad01130  Biosynthesis of antibiotics
sad01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sad00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAAV_2675
   00620 Pyruvate metabolism
    SAAV_2675
   00640 Propanoate metabolism
    SAAV_2675
  Energy metabolism
   00680 Methane metabolism
    SAAV_2675
Enzymes [BR:sad01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SAAV_2675
Lipid biosynthesis proteins [BR:sad01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SAAV_2675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Atu4866
Motif
Other DBs
NCBI-ProteinID: ACY12505
Position
complement(2699298..2700896)
Genome map
AA seq 532 aa AA seqDB search
MQKSALFAPEKYNIISEIEKYSHIPDKKAILYHNTEGEDISVTYQQLIEQSNKVGNVLAS
HGLSKGDKVLIMMPRSIATYELYIAALKLGVAIIPCSEMLRTKDLQYRITHGEINAVIAL
EPFTVEFEKIKEYDALTKFVIAGQKDGWISLEAEKENASNKLEMADTTRDDMAILSYTSG
TTGNPKAVTHCHGWGFAHLQMAPKHWLCINEDDLVWATAAPGWQKWVWSPFLSVLGSGAT
AFVFNGRFSPETYLELLQKYQINVLCCTPTEYRMMAKLQNLNDYDLTHLHSAVSAGEPLN
REVVEQFKKYFNLTVRDGYGQTESTLLIGFLKDTPQRIGSMGKGIPGSSVTVVDDEGNSV
PANTKGNIAVPLDLPALFKGYYKEPERTAKAQTGKYYITGDLAHVDDDGYFWFEGRRDDI
IISSGYTIGPFEVEDALTNHPAVKECAVVAKPHDIRGNIVKAFVILQDHTAGDDTLVKEL
QQFVKNEVAPYKYPREIEFVDDLPKTNSGKIRRVELRDSEIEKWQQQKDSNQ
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagtcagctctattcgcgcctgaaaaatataacattatttcggaaatcgaaaaa
tatagccacataccagataaaaaggcaattttatatcataatactgaaggcgaagatata
tcagtcacttaccaacagctcattgaacagtctaataaagtaggtaatgttttagcatcg
cacggtttatctaaaggcgataaagtactcattatgatgccacgatctattgcgacgtat
gaattatatattgctgctttaaaattaggtgttgcaatcattccatgttctgaaatgcta
agaactaaagatttacaataccgtatcacgcacggtgaaataaatgcagttattgcacta
gagccattcacagttgaatttgaaaaaattaaagaatatgatgcgttaactaaatttgtt
attgccggtcaaaaagatggatggatttcacttgaagctgaaaaagaaaacgcaagtaac
aaactagaaatggcagatacgacgcgtgatgatatggcgattctgtcatatacatctggt
acaactggcaatcctaaagccgttacacattgtcatggatggggatttgcacatttacaa
atggcaccaaaacattggttatgtattaatgaagatgacttagtttgggcaacagcagca
ccaggttggcaaaaatgggtatggagtcctttcttatctgtattaggttcaggtgcaact
gcttttgtatttaatggaaggttcagtcctgaaacatacttagaattgcttcaaaaatat
caaattaatgttttatgttgtacaccgacagaatatcgtatgatggctaaattacagaac
ttaaatgattatgacttaacgcatttacatagtgccgtttctgcaggtgagccactaaat
cgagaagtagttgaacaattcaagaaatactttaatttaactgtaagagatggatatggc
cagactgaaagtaccttgcttataggctttttaaaagatacaccacagaggattggatca
atgggtaaaggcattccaggtagttcggtcactgtagtagatgatgaggggaatagcgta
cctgctaatacgaaagggaatattgcagtaccacttgatttgccagcacttttcaaaggg
tattataaagagccagaacgtacggcgaaagcgcaaacaggtaaatactacatcactggt
gacttagctcatgtagatgatgatggttatttctggtttgaaggacgtcgagatgacatt
attattagttcaggctatacgattgggccttttgaagttgaagatgcgttaacgaatcat
ccagccgttaaagaatgtgctgtagtagcaaaacctcatgatatacgaggaaatattgtt
aaagcattcgttattttacaggaccatactgcgggtgatgatacgttagttaaagaacta
caacaatttgttaaaaatgaagttgcaccatataaatatccgagagagattgaattcgtt
gacgacttaccaaaaacaaactcaggtaaaattcgtcgtgttgaactacgagattctgaa
atagaaaaatggcaacaacaaaaagatagcaatcaataa

DBGET integrated database retrieval system