KEGG   Staphylococcus aureus subsp. aureus ED98: SAAV_2688Help
Entry
SAAV_2688         CDS       T01124                                 

Gene name
gpxA2
Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sad  Staphylococcus aureus subsp. aureus ED98
Pathway
sad00480  Glutathione metabolism
sad00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sad00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SAAV_2688 (gpxA2)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SAAV_2688 (gpxA2)
Enzymes [BR:sad01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SAAV_2688 (gpxA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF2691 SCO1-SenC
Motif
Other DBs
NCBI-ProteinID: ACY12518
Position
complement(2716269..2716766)
Genome map
AA seq 165 aa AA seqDB search
MNNRNVYDIEVSDYKGLTYKLEAFRGKVILVVNTATECIYSEQLKKLETLFQKYKDRGFV
VLSFPNNNFDNRQPGSNEEILKISREKFGVTFPVLAKISVNGNDEHPLFTHLKNEQPGIF
GSPIKWNFTKFIIDRQGNVVNRFLPMEDPLDISTNIEILLQESSS
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaataatagaaatgtgtatgatatcgaagtaagtgattataaaggcttaacttataaa
ttagaagcatttagaggtaaagtgattttagttgttaatactgcaacagaatgtatatat
agcgaacaattgaaaaaactagagactttgtttcaaaaatataaggatcgtgggtttgta
gtgttgagttttccgaataataattttgacaatcgacaaccaggttctaatgaagaaatc
ttgaaaattagtcgtgagaaatttggtgttacatttccagtgctagctaaaatatctgtg
aacgggaacgatgaacatccgttatttacgcatttaaagaatgaacaaccaggaatcttt
gggtccccaataaaatggaatttcacaaaatttataatcgatcgacaaggcaatgttgta
aatcgattcttgccaatggaagatccattggatatatcgacaaatatagaaatattattg
caagaatcttcatcttaa

DBGET integrated database retrieval system