KEGG   Staphylococcus aureus subsp. aureus ED98: SAAV_2695Help
Entry
SAAV_2695         CDS       T01124                                 

Definition
alkaline phosphatase family protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sad  Staphylococcus aureus subsp. aureus ED98
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sad00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAAV_2695
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SAAV_2695
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SAAV_2695
Enzymes [BR:sad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SAAV_2695
Exosome [BR:sad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAAV_2695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2723037..2724461
Genome map
AA seq 474 aa AA seqDB search
MLSVKKATKFAVANLIIVSTVFSSVTPAIAQSDKSSKDESFAVGNTKNPKNVIFLVGDGM
GPSFNTAYRYYKNDSHAKEMTPTAFDSYLKGTNRTYSNDPKQNITDSAAGGTSFSSGHKT
YNGAIGVDSNKQKVKTVLERAKEKGKSTGLVSTAELTDATPAAYAAHVTSRDDKNEIAKQ
FYKDKINGKHKVDVLLGGGAKYFGKSNGNLDKKFKKDGYDLATNSKDLSKSDKDKVLGLF
ADKNMPLAIDASKDEPSLADMQQSALSKLERNKKGFFLMVEGASIDKSAHSNDITGVMSE
MEGFEKAFDDAIQYAKKHKDTLVVATADHSTGGLTIGKDKGYEWNPQPIKSMKHSGSYMT
EKMAKGEDPEKVINEGYGFEFSQDDMKKVKKENKKLQKLLKKEKDEKSADVEKQTKALQH
AIQKPVNDKSYTGWTSDGHTGEDVNTYAYGPRSESFSGNIENTESAKIIFDIFK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgttatcagttaaaaaagccacaaaatttgcagttgctaaccttattatcgtgtcaaca
gttttcagttctgtcacacctgcaattgcgcaatccgataaaagttctaaagatgaaagt
ttcgcggttggtaatactaaaaatccaaaaaatgttatctttttagttggcgatggcatg
ggtccatcatttaacacagcttatcgttattataaaaatgattcgcatgccaaagaaatg
acccctactgcttttgattcatatttaaaaggcacaaatcgtacatattcaaatgaccca
aaacagaatattactgattctgcagctggcggaacatcctttagttctggccataagaca
tataatggtgccatcggtgttgacagtaacaagcagaaagtaaagacagtgcttgaacgt
gcaaaagaaaaaggtaagtcgactggtcttgtttcaacagctgaattaacagatgcaaca
ccagcagcatatgctgcacacgtgacttctagagatgataaaaacgaaatcgctaaacaa
ttttataaagataaaatcaacggaaagcataaagttgatgttttattaggcggcggcgct
aaatatttcggtaaaagtaatggcaatttagataaaaaattcaaaaaagatggttacgac
cttgccacgaacagtaaggatttatcaaaatctgataaagataaagttcttggtttgttt
gcagataaaaatatgccacttgcaatagatgcttctaaagacgaaccatcattagctgat
atgcaacaaagtgcacttagtaagcttgagcgtaataaaaaaggtttctttttaatggtc
gaaggtgcttctatagataaatcagcgcattccaacgatattacaggcgttatgtctgaa
atggaaggttttgaaaaagcattcgatgacgccattcaatatgctaagaaacataaagat
acacttgtcgttgcaacagcagatcactctactggtggtctaacaattggtaaagataaa
ggatacgaatggaatcctcaaccgattaaatcgatgaaacactctggatcatatatgaca
gaaaaaatggctaaaggtgaagaccctgaaaaagttattaatgaaggttatggctttgaa
ttttcacaagatgatatgaaaaaggttaaaaaagagaataaaaagttgcaaaaattactt
aaaaaagaaaaagacgaaaaatctgcagatgtagaaaaacaaacaaaagccttacaacac
gcaattcagaagccagtaaatgataaatcttatacagggtggacttccgatggacataca
ggcgaggatgttaatacctacgcttacggacctagatcagaatcatttagtggtaatatc
gaaaatacagaaagcgcaaaaataatatttgatatattcaagtaa

DBGET integrated database retrieval system