KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_0422Help
Entry
NWMN_0422         CDS       T00557                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
473298..474032
Genome map
AA seq 244 aa AA seqDB search
MRIKTPSPSYLKGTNGHAILLLHSFTGTNRDVKHLAAELNDQGFSCYAPNYPGHGLLLKD
FMTYNVDDWWEEVEKAYQFLVNEGYESISATGVSLGGLMTLKLAQHYPLKRIAVMSAPKE
KSDDGLIEHLVYYSQRMSNILNLDQQASSAQLAAIDDYEGEITKFQHFIDDIMTNLNVIK
MPANILFGGKDAPSYETSAHFIYEHLGSVDKELNGLKDSHHLMTHGEGRDILEENVIRFF
NALT
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgagaattaaaacaccgagtccatcgtatttaaaaggcacaaatggacatgcgatatta
ttattacattcatttacaggtacaaatcgggatgtgaagcatcttgcagctgagttaaat
gaccaaggatttagttgttatgcaccgaattatccaggtcatggtttattgttgaaagat
ttcatgacatataatgtagatgattggtgggaagaagttgagaaagcttaccaattttta
gtcaatgaaggttatgaatctatcagtgcaacgggtgtgtctttaggtggattaatgaca
ttaaaattggcgcaacactatcctttgaaacgtatcgctgtcatgtcagcaccaaaggaa
aagagtgacgatggcttaatagaacatttagtttattatagtcaacgcatgtcgaatatt
ttaaatttagatcagcaagcatcgagtgcgcaattagcagcaattgatgattatgaaggt
gaaattacgaagtttcaacattttattgatgatatcatgacaaatttaaatgttattaaa
atgccagctaatatattatttggtggtaaagatgcgccatcctatgaaacaagtgcacat
tttatttatgaacatttaggatcagtagacaaagaattaaatggtctgaaggattcgcat
catttaatgacgcatggagaaggcagagatattttagaagaaaatgttattcgctttttc
aatgctttaacataa

DBGET integrated database retrieval system