KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_0577Help
Entry
NWMN_0577         CDS       T00557                                 

Gene name
adh1
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sae00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    NWMN_0577 (adh1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NWMN_0577 (adh1)
  Lipid metabolism
   00071 Fatty acid degradation
    NWMN_0577 (adh1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    NWMN_0577 (adh1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NWMN_0577 (adh1)
   00626 Naphthalene degradation
    NWMN_0577 (adh1)
Enzymes [BR:sae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NWMN_0577 (adh1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
657833..658843
Genome map
AA seq 336 aa AA seqDB search
MRAAVVTKDHKVSIEDKKLRALKPGEALVQTEYCGVCHTDLHVKNADFGDVTGVTLGHEG
IGKVIEVAEDVESLKIGDRVSIAWMFESCGRCEYCTTGRETLCRSVKNAGYTVDGAMAEQ
VIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVSNVKPGQWLGVFGIGGLGNLALQY
AKNVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEVMKLTDNKGLDATVVTSVA
KTPFNQAVDVVKAGARVVAVGLPVDKMNLDIPRLVLDGIEVVGSLVGTRQDLREAFEFAA
ENKVTPKVQLRKLEEINDIFEEMENGTITGRMVIKF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagcagttgtaacgaaagatcacaaagtaagtattgaggacaaaaagttaaga
gctttaaaacctggtgaagcgttggtacaaacggaatattgtggcgtttgtcataccgat
ttacatgttaagaatgctgattttggtgatgttacaggcgttactttaggtcatgaaggt
attggtaaagtcatcgaagttgcggaagatgtagaatcattaaaaattggagaccgtgtg
tctatcgcttggatgttcgaaagctgtggaagatgtgaatattgtacaacaggtcgtgaa
acactttgccgtagtgtgaaaaatgctggttatacagtagatggtgcaatggctgaacaa
gttattgttactgcagactatgctgtgaaagtacctgaaaaattagatccagcagcagcg
tcttctattacatgcgcaggtgtgacaacttataaagctgtaaaagtaagtaatgtaaaa
cctggacaatggttaggtgtttttggtataggtggtttaggtaacctagctttacaatat
gctaaaaacgttatgggggctaaaattgttgccttcgacatcaatgatgataaattagca
ttcgcgaaagaattaggtgctgatgctattattaattctaaagatgttgatccagttgca
gaagttatgaaattaactgataacaaaggattagatgcaacagtggtaacttcagttgct
aagacgccatttaaccaagcggttgatgttgtaaaagctggtgcaagagttgttgccgtt
ggtttacctgttgataaaatgaacttagatatcccaagattagtgcttgatggtattgaa
gtagtaggttcacttgttggtacaagacaagacttacgtgaagcgtttgaatttgctgct
gaaaataaagtaacacctaaagttcaattaagaaaattagaagaaatcaatgatattttt
gaagaaatggaaaatggtactataactggtagaatggttattaaattttaa

DBGET integrated database retrieval system