KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_0803Help
Entry
NWMN_0803         CDS       T00557                                 

Gene name
dltA
Definition
D-alanine--poly(phosphoribitol) ligase subunit 1 (EC:6.1.1.13)
Orthology
K03367  
D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Pathway
D-Alanine metabolism
Staphylococcus aureus infection
Class
Metabolism; Metabolism of other amino acids; D-Alanine metabolism [PATH:sae00473]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:sae05150]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
891065..892522
Genome map
AA seq 485 aa AA seqDB search
MTDIINKLQAFADANPQSIAVRHTTDELTYQQLMDESSKLAHRLQGSKKPMILFGHMSPY
MIVGMIGAIKAGCGYVPVDTSIPEDRIKMIINKVQPEFVFNTTDESFESLEGEVFTIEDI
KTSQDPVIFDSQIKDNDTVYTIFTSGSTGEPKGVQIEYASLVQFTEWMLELNKSGNEQQW
LNQAPFSFDLSVMAIYPCLASGGTLNLVDKNMINKPKLLNEMLTATPINIWVSTPSFMEM
CLLLPTLNEEQYGSLNEFFFCGEILPHRAAKALVNRFPSATIYNTYGPTEATVAVTSIQI
TQEILDQYPTLPVGVERPGARLSTTDEGELVIEGQSVSLGYLKNDQKTAEVFNFDDGIRT
YHTGDKAKFENGQWFIQGRIDFQIKLNGYRMELEEIETQLRQSEFVKEAIVVPVYKNDKV
IHLIGAIVPTTEVTDNAEMTKNIKNDLKSRLPEYMIPRKFEWMEQLPLTSNGKIDRKKIA
EVING
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgacagatattattaacaagctgcaagcgtttgcggatgcaaatccacaaagcattgct
gttagacacacaactgatgaattaacttatcaacagttaatggatgagtctagtaaatta
gcacatcgattacaaggtagtaagaaaccgatgattttattcggtcacatgtcaccatat
atgattgttgggatgattggtgccattaaagcaggatgtggatatgtacctgtagacact
tcaattcctgaagaccgtattaaaatgattattaacaaggttcaaccagagtttgtattt
aatacgactgatgaatcatttgaaagtttagaaggcgaagtatttacaatagaagatatt
aaaacatctcaagacccagtaatttttgatagtcagattaaagataacgacacagtatac
acaatctttacatctggttctactggggaacctaaaggtgttcaaattgaatatgcaagt
ttagttcaatttactgagtggatgttagaacttaataaatcaggaaatgaacaacaatgg
cttaaccaagcgccattttcatttgatttatctgtaatggctatttatccatgtttagca
tcaggcggtacattaaatcttgtagataaaaacatgattaataaacctaaattattaaat
gaaatgctaacagcaacaccgattaacatttgggtatcaacaccatcatttatggaaatg
tgtttattattaccaacgcttaatgaagaacaatatggtagtcttaacgaattcttcttc
tgtggtgaaattctacctcacagagcagcaaaagcgttagtaaaccgtttcccaagtgcg
acgatttacaacacatatggtccaactgaagctacggtagcagttacaagtattcaaatt
acacaagaaatcttagatcaatatccgacattacctgttggcgttgaaagaccaggcgca
agattatctactacagatgaaggtgaacttgttatcgaaggtcaaagtgtaagtttagga
tacttaaaaaatgaccaaaaaacagctgaagtatttaatttcgatgacggtattcgtaca
tatcacactggtgataaagcgaagtttgaaaatggtcaatggttcattcaaggtcgtatt
gatttccaaatcaaattgaatggctacagaatggaattagaagaaattgaaacacaatta
cgccagtctgagttcgtaaaagaagcgattgttgtacctgtatataaaaatgataaagtt
attcatttaattggtgcaattgtgccaacgactgaagttacggacaatgcagaaatgact
aaaaatattaaaaatgacttgaaatcacgcttaccagagtatatgattcctagaaagttt
gaatggatggaacaattgccattgacttcaaatggtaaaattgacagaaagaaaattgca
gaggtaattaacggatga

DBGET integrated database retrieval system