KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_1208Help
Entry
NWMN_1208         CDS       T00557                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sae00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    NWMN_1208 (glpK)
Enzymes [BR:sae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     NWMN_1208 (glpK)
Exosome [BR:sae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NWMN_1208 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1333237..1334733
Genome map
AA seq 498 aa AA seqDB search
MEKYILSIDQGTTSSRAILFNQKGEIAGVAQREFKQYFPQSGWVEHDANEIWTSVLAVMT
EVINENDVRADQIAGIGITNQRETTVVWDKHTGRPIYHAIVWQSRQTQSICSELKQQGYE
QTFRDKTGLLLDPYFAGTKVKWILDNVEGAREKAENGDLLFGTIDTWLVWKLSGKAAHIT
DYSNASRTLMFNIHDLEWDDELLELLTVPKNMLPEVKASSEVYGKTIDYHFYGQEVPIAG
VAGDQQAALFGQACFERGDVKNTYGTGGFMLMNTGDKAVKSESGLLTTIAYGIDGKVNYA
LEGSIFVSGSAIQWLRDGLRMINSAPQSESYATRVDSTEGVYVVPAFVGLGTPYWDSEAR
GAIFGLTRGTEKEHFIRATLESLCYQTRDVMEAMSKDSGIDVQSLRVDGGAVKNNFIMQF
QADIVNTSVERPEIQETTALGAAFLAGLAVGFWESKDDIAKNWKLEEKFDPKMDEGEREK
LYRGWKKAVEATQVFKTE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatatattttatctatagaccaaggaacaacaagctcaagagcgattttattc
aatcaaaaaggggaaattgcaggggtagcacaacgtgagtttaagcaatattttccacaa
tcaggttgggttgaacatgatgcaaatgaaatttggacatctgtgttagctgtaatgacg
gaagtaattaatgaaaatgatgttagagctgatcaaattgcaggtatcggtattacaaac
caacgtgaaacaacggttgtttgggacaaacatactggccgcccaatttatcacgcaatt
gtttggcaatcacgtcaaacacaatcaatttgttcagaattaaaacaacaaggatatgaa
caaacatttagagataagacaggattacttttagatccgtattttgcaggtacaaaagtt
aaatggattctagacaatgttgaaggtgcacgagaaaaagcagaaaatggcgatctatta
tttggaacgattgatacttggttagtatggaaattatcaggaaaagctgcgcatattact
gattattcaaatgcgagtcgtacattaatgtttaatatccatgatttagaatgggacgat
gagttattagaactacttacagtacctaaaaatatgttgccagaagttaaagcttcgagt
gaagtatatggtaagacaattgattaccacttctatggtcaagaagtaccaatcgctgga
gtagctggtgatcaacaagcagcattatttggacaagcttgcttcgaacgtggtgacgtg
aaaaacacatatggaactggtggcttcatgttaatgaatacaggtgacaaagcggttaaa
tctgaaagtggtttattaacaacaattgcttatggtattgatggaaaagtaaattatgcg
cttgaaggttccatctttgtttcgggttcagcaatccaatggttacgtgatggattaaga
atgattaattcagcaccacaatcagaaagttatgcgacacgagttgactctactgagggt
gtttatgttgttccagcttttgtaggtttaggaacaccatattgggattctgaagcacgt
ggtgcgattttcggtttaacacgtggaactgaaaaagagcactttatccgtgcaacttta
gaatcactatgttaccaaactcgtgacgttatggaagcaatgtcaaaagactctggtatt
gatgtccaaagtttacgtgtcgatggtggtgcagttaaaaataactttattatgcagttc
caagcagacattgttaatacttctgttgaaagacctgaaattcaagaaactacagcttta
ggtgctgcatttttagcaggtttagcagttggattctgggagagtaaagatgatatcgct
aaaaactggaaattagaagaaaaattcgatccgaaaatggatgaaggcgaaagagaaaaa
ttatatagaggttggaaaaaagctgttgaagcaacacaagtttttaaaacagaataa

DBGET integrated database retrieval system