KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_1241Help
Entry
NWMN_1241         CDS       T00557                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sae01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sae00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:sae00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1364661..1365722
Genome map
AA seq 353 aa AA seqDB search
MRRWQGLVEEFKAHLPVNENTPKLTLNEGNTPLIHCENMSKILGIDLYVKYEGANPTGSF
KDRGMVMAVTKAKEQGKKIVICASTGNTSASAAAYAARAGLKAIVVIPEGKIALGKLSQA
VMYGAEIVSIEGNFDEALEIVKEIAKSGEIELVNSVNPFRIEGQKTGSFEIVQQLDGEAP
DILAIPVGNAGNITAYWKGFKEYHEAKGSQLPKMFGFQAEGASPIVQNKVIKNPETIATA
IRIGNPASWDKATNALKESNGLIDSVTDDEILEAYQLMTTKEGVFSEPASNASIAGLIKL
HRQGKLPQGKKVVAILTGNGLKDPDTAISLLDNPIKPLPNDKDSIIDYIKGAL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagaagatggcaaggattagtagaagagtttaaagcacatttaccagtaaatgaaaat
acaccaaaattaacattgaacgagggaaatacaccactcattcattgtgaaaatatgtct
aaaatactaggcatagatttatatgtgaagtatgaaggtgccaatccgacaggttcattt
aaagatcgcggtatggtaatggctgtgacaaaagcaaaagagcaaggtaagaaaattgta
atatgcgcttcgactggaaatacatcagcgtctgcagcagcatatgcagcgagagcaggt
ttaaaagctatcgtcgtaataccagaaggtaaaattgcattaggtaaattgtcgcaagca
gtaatgtatggtgcagaaatcgtttctattgaaggaaactttgatgaagctttagaaatt
gtaaaagaaattgcaaaaagtggcgaaatcgagcttgtaaactctgtcaatccatttaga
atcgaaggacaaaagacaggctcatttgaaattgtacaacaattagacggtgaagcacct
gatattttagcgattcctgtaggtaatgcaggtaatattactgcatattggaaaggcttt
aaagaatatcatgaagctaaaggatcacaattgccgaaaatgtttggcttccaagctgaa
ggcgcatcaccaattgttcaaaataaagtcattaaaaatcctgaaacgattgcaactgct
attcgaattggtaatcctgctagttgggataaggcgactaatgctcttaaagaatcaaat
ggattaatagatagtgttactgatgatgaaattctagaagcatatcagttaatgacaact
aaagaaggtgtctttagtgaaccagcgagtaatgcttctattgcaggtttaattaaattg
catagacaaggtaaattacctcaaggtaaaaaagtagttgctattttaactggtaatgga
ttaaaagatcctgatactgctatttcactactagataatccgataaagccattgccaaat
gataaagatagcattatcgattatattaaaggagctttataa

DBGET integrated database retrieval system