KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_1451Help
Entry
NWMN_1451         CDS       T00557                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NWMN_1451 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NWMN_1451 (glk)
   00052 Galactose metabolism
    NWMN_1451 (glk)
   00500 Starch and sucrose metabolism
    NWMN_1451 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    NWMN_1451 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NWMN_1451 (glk)
   00524 Butirosin and neomycin biosynthesis
    NWMN_1451 (glk)
Enzymes [BR:sae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     NWMN_1451 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1618090..1619076)
Genome map
AA seq 328 aa AA seqDB search
MTKIILAADVGGTTCKLGIFTPELEQLHKWSIHTDTSDSTGYTLLKGIYDSFVEKVNENN
YNFSNVLGVGIGVPGPVDFEKGTVNGAVNLYWPEKVNVREIFEQFVDCPVYVDNDANIAA
LGEKHKGAGEGADDVVAITLGTGLGGGIISNGEIVHGHNGSGAEIGHFRADFDQRFKCNC
GRSGCIETVASATGVVNLVNFYYPKLTFRSSILELIKENKVTAKAVFDAAKAGDQFCIFI
TEKVANYIGYLCSIISVTSNPKYIVLGGGMSTAGPILIENIKTEYHNLTFAPAQFETEIV
QAKLGNDAGITGAAGLIKTYVLDKEGVK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattattttagcagctgatgtaggcgggacgacttgtaaattaggtattttc
acacctgaattagaacaattacataaatggtctattcacactgatacatctgatagtaca
ggatatacacttttgaaaggaatttatgattcgtttgttgaaaaagtaaatgaaaataat
tataatttttcaaatgtacttggcgtaggtattggtgtaccaggtcctgttgactttgaa
aaaggtacagtaaatggagcagtaaacttatattggccagaaaaagttaatgtacgtgag
atttttgaacaattcgttgattgtccagtgtatgtagataatgatgctaacatagctgct
ttaggggagaaacacaaaggtgctggtgaaggtgccgatgatgttgttgccatcacactt
ggtacaggtctaggtggaggaattatttcaaatggtgaaatcgtacatggtcataatggc
tctggcgcagaaataggtcattttagagcagacttcgatcaacgatttaaatgtaattgt
ggtcgttctggatgtattgaaacagttgcttcagcgacaggcgttgttaacttagttaac
ttctactatccgaagttgacgtttagatcttctatattagaattgattaaagaaaataag
gttacagcaaaagctgtttttgatgcggcaaaagctggtgaccaattctgtattttcatt
actgaaaaggttgcaaactatattggatatttatgtagtattattagtgttacaagtaat
ccgaaatatatcgttctaggtggaggaatgtctactgcaggacctattttaattgaaaat
attaaaacagaatatcataatttaacatttgcacctgctcaatttgaaactgaaattgta
caagcgaaattaggtaatgatgcaggtattacaggagcagcaggattaatcaagacctat
gtattagataaagagggggtaaaataa

DBGET integrated database retrieval system