KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_1520Help
Entry
NWMN_1520         CDS       T00557                                 

Definition
(GenBank) helicase RecD/TraA family protein
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Pathway
sae03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sae00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NWMN_1520
Enzymes [BR:sae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     NWMN_1520
DNA repair and recombination proteins [BR:sae03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     NWMN_1520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 AAA_11 Viral_helicase1 HHH_5 T2SSE AAA AAA_12 AAA_18 AAA_14 AAA_29 Mg_chelatase NTPase_1 TsaE Helicase_RecD ABC_tran HHH_3 UvrD_C 5_3_exonuc AAA_28 RsgA_GTPase Zeta_toxin AAA_22 AAA_16 DUF815 NACHT
Motif
Other DBs
NCBI-ProteinID: BAF67792
UniProt: A0A0H3KGT6
Position
complement(1685031..1687508)
Genome map
AA seq 825 aa AA seqDB search
MSDPTLFDYSMIKGTVEAILFQNSDNFYTVLKVDTIETNEDFDTMPTVVGFLPNIVEGDV
YTFKGQVVDHPRYGKQLKAETFEKEMPQTKEAIISYLSSDLFKGVGKKTAQNIVNTLGDN
AINDILDDHSVLEKVSGLSKKKQKQIAEQISANQESEKIMIRLHDLGFGPKLSMAIYQFY
LGDTLTILDRNPYQLIYDIKGIGFNKADQLARNIGIAYNDNERLKAALLYTLEEECIKQG
HTYLPINVVIDLTVDVLNYQDEEVIEPEKLDEMLQYLNEEKRLIIDNEQVAIPSLYYSEI
KSVQNLFRIKTHTNKLTEIEQSDLQMHIGEIEDANQVNYAASQKEALQTAINSKVMLLTG
GPGTGKTTVIKGIVELYAEIHGLSLDYDDYVNDDYPVVLAAPTGRASKRLQESTGLEAMT
IHRLIGWNQDTKPEDILENEINARLIIIDEMSMVDTWLFHQFLSAVPLDAQLIFVGDEDQ
LPSVGPGQVFKDLIESKAIPRVNLTEVYRQQDGSSIIELAHRMKLGQKIDITQRFHDRSF
INCQANQIPTVVEKVVTSAVNKGYTMADIQVLAPMYKGNAGIKRLNQVLQDILNPKKKDT
REIEFGDVVFRKGDKVLQLVNRPNDNIFNGDIGVIVGIFWAKENALNKDVLVVDFEGNEI
TFTKQDMMELTHAYCTSIHKSQGSEFPIVIMPIVKQYFRMLQRPILYTGLTRAKTSLVLL
GDPEAFDIGLKTNGQARLTQLCTLLKNYFNSEDEEMLENTATNDTGASQTTIDDQVEAPM
SSNDSEEVMSDSTKTDTNVLTEATMFKIDPMINMGEITPYDFIER
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaccctacactatttgattattcaatgatcaaaggtactgttgaagcgatattg
tttcaaaacagtgataatttttatacagtgcttaaagtagatactattgaaacaaatgaa
gactttgatacaatgccaactgttgtagggtttcttccgaatattgttgaaggcgatgtc
tacacatttaaagggcaagttgttgatcatccacgttatggtaaacaattaaaagcagag
acttttgaaaaagaaatgccacaaacgaaagaagcaattataagttatttatctagtgat
ttgtttaaaggtgtaggtaaaaagacagctcaaaatattgttaatacattaggtgacaat
gcgataaatgatatattagatgaccattcagtgctagaaaaagtttcgggattatctaaa
aagaaacagaaacaaattgcagaacaaatttcagcaaatcaagaatctgaaaaaataatg
attcgtttacatgatttagggtttggtcctaaactttcaatggcaatttatcagttttat
ctcggcgatacactgactattttagatcgaaatccatatcaattgatttatgatattaaa
ggtattggttttaataaagcagatcaacttgctagaaatattggtatcgcttataacgat
aatgaacgattaaaagctgcgttgctctatacgttagaagaagaatgtattaaacaggga
catacatatttgcctatcaatgttgttatagatttaacggttgatgtattaaattatcaa
gatgaagaggtcatcgaacctgaaaaattagacgaaatgttgcaatacttaaatgaggaa
aaacgactaattattgacaatgaacaagttgcaattccaagtttgtattattctgaaatc
aaaagtgttcaaaacttattcagaataaagacgcatacaaataaacttacagaaattgaa
cagtcagatttacaaatgcatattggtgaaatagaagatgcgaatcaagtgaactatgca
gcttcacaaaaagaagctttgcaaacggctatcaattctaaggtgatgctattaaccggt
ggaccgggaacaggaaaaacgacagtaattaaaggtattgttgaattatatgctgagatt
catggcttatcattagattatgatgattatgtcaatgatgattatccagttgtattagca
gcgccaacaggaagagcgtctaagagactacaagagtcaactggattagaagcaatgacg
attcatcgtttaataggttggaatcaagacacaaagccagaggatatattagaaaatgaa
ataaacgcacgactcataatcattgatgagatgtctatggtagatacttggttgttccac
caatttttaagtgcagttcctttagatgcacaattgatatttgtaggtgatgaggaccaa
ttgccttctgtaggtcctggtcaagtatttaaagatttaattgaatcgaaagctatacca
cgagtaaatctgactgaagtatatcgtcaacaagatggttcaagcattatagaattagca
catcgaatgaagttgggtcagaaaattgatattacacagcgttttcatgatagaagtttt
attaactgtcaggcaaaccaaataccaacagttgttgagaaggtagttactagtgctgtt
aataaagggtatactatggctgatattcaagtgcttgcaccaatgtataaaggaaatgcc
ggtattaaacgtttaaatcaagttttacaagatattttaaaccctaaaaagaaagacaca
cgagaaattgagtttggtgatgtagtctttagaaaaggtgacaaagtattacaacttgtt
aataggccaaatgataacatattcaatggtgacataggagttattgttggtattttttgg
gcgaaagaaaatgcccttaataaagatgtacttgttgtggattttgaaggtaatgaaatt
acatttacgaaacaagatatgatggaattaacacatgcttattgtacatcaatccataaa
tcacaaggttcagaatttcctattgttatcatgcctattgttaaacagtattttagaatg
ttacaaagaccgatattatatactggtttaactagagcgaaaacgagtttagttttactt
ggtgatccggaagcatttgatattggattgaaaacaaatggtcaagcgcgtttaacacaa
ttatgtacattgttgaaaaattattttaattcagaagatgaagaaatgctggaaaacaca
gcaactaatgatacaggagcttcacaaacgacaatagatgatcaagtagaagcgccaatg
tcatcgaatgatagtgaagaagttatgtctgattcaacaaaaacagatacaaatgtatta
acggaagctacaatgtttaaaattgacccaatgattaatatgggagaaatcacgccgtat
gactttatagaacgttga

DBGET integrated database retrieval system