KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_2028Help
Entry
NWMN_2028         CDS       T00557                                 

Gene name
murZ
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sae00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NWMN_2028 (murZ)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NWMN_2028 (murZ)
Enzymes [BR:sae01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     NWMN_2028 (murZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2244285..2245544)
Genome map
AA seq 419 aa AA seqDB search
MAQEVIKIRGGRTLNGEVNISGAKNSAVAIIPATLLAQGHVKLEGLPQISDVKTLVSLLE
DLNIKASLNGTELEVDTTEIQNAALPNNKVESLRASYYMMGAMLGRFKKCVIGLPGGCPL
GPRPIDQHIKGFKALGAEIDESSTTSMKIEAKELKGAHIFLDMVSVGATINIMLAAVYAT
GQTVIENAAKEPEVVDVANFLTSMGANIKGAGTSTIKINGVKELHGSEYQVIPDRIEAGT
YMCIAAACGENVILNNIVPKHVETLTAKFSELGVNVDVRDERIRINNNAPYQFVDIKTLV
YPGFATDLQQPITPLLFMANGPSFVTDTIYPERFKHVEELKRMGANIEVDEGTATIKPST
LHGAEVYASDLRAGACLIIAGLIAEGVTTIYNVKHIYRGYTDIVEHLKALGADIWTETV
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggctcaagaggtaataaaaataagaggtggacgcacactaaatggggaagttaatatc
agtggcgcgaaaaacagtgctgtagctatcattcctgcaacattattagctcaaggacat
gtgaaattagaagggttaccgcaaatctctgatgttaaaactttagtgagtttattagaa
gatttaaatattaaggcatcactaaatggtacggaattagaagttgatacaactgaaata
caaaatgctgcattaccaaataataaagttgaatcattacgtgcttcatactatatgatg
ggtgccatgttaggtagatttaaaaaatgtgtgattggtttaccgggaggatgtccactt
gggccacgtccaattgatcaacatattaaaggatttaaagctttaggtgctgaaattgat
gaatcaagtacgacatcaatgaaaatcgaagctaaagagttaaaaggtgcacatattttt
ctagatatggttagcgtaggtgcaacaattaacattatgctagctgcagtttatgcaaca
ggacaaactgtaattgaaaatgctgctaaagaaccggaagtagttgatgttgctaacttc
ttaacaagtatgggagctaatattaagggagcgggtacatcaacaattaaaatcaatggc
gtcaaagaattacatggttctgagtatcaagttatacctgatagaattgaagcaggcaca
tatatgtgtatcgctgcagcatgtggagaaaatgttatattaaataatattgttccgaaa
catgtagaaacattaactgctaaatttagtgaattaggtgtgaatgttgatgtaagagac
gaaagaattcgcatcaataataatgcgccatatcaatttgttgatattaaaacactagta
tatccaggttttgctactgatttgcaacagcctattacaccattattatttatggcaaat
ggtccttcatttgtaactgatacgatttatccggagcgttttaaacatgttgaagaatta
aagcgcatgggtgcaaatattgaagttgacgaaggcacagcaacgataaaaccatcaaca
ttacatggtgctgaagtttatgctagcgatttaagagcaggagcttgtttaattattgct
ggtttaattgctgagggtgtaactacaatttacaatgttaaacatatttatagaggttat
acagatattgtagaacacttaaaagctttaggtgcagatatttggacggaaactgtatag

DBGET integrated database retrieval system