KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_2395Help
Entry
NWMN_2395         CDS       T00557                                 

Gene name
gtaB
Definition
UTP-glucose-1-phosphate uridyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sae00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NWMN_2395 (gtaB)
   00052 Galactose metabolism
    NWMN_2395 (gtaB)
   00500 Starch and sucrose metabolism
    NWMN_2395 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    NWMN_2395 (gtaB)
Enzymes [BR:sae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NWMN_2395 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2634278..2635144)
Genome map
AA seq 288 aa AA seqDB search
MKKIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRH
KRAIEDHFDSQKELEMVLKEKGKSELLEKVQYSTELANIFYVRQKEQKGLGHAISSARQF
IGNEPFAVLLGDDIVESEVPAVKQLIDVYEETGHSVIGVQEVPEADTHRYGIIDPLTKNG
RQYEVKKFVEKPAQGTAPSNLAIMGRYVLTPEIFDYLKTQKEGAGNEIQLTDAIERMNND
NQVYAYDFEGERYDVGEKLGFVKTTIEYALKDDSMREELTRFIKALGL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaataaaaaaggcaatcattcccgctgctggtttagggactagatttttacca
gcaactaaagcgatgccaaaggaaatgcttcctatcttagataaacccacaatacaatat
atcgttgaagaagctgcaagagctggaattgaagatattattatagtgacaggtcgccac
aaacgcgcgattgaagatcattttgatagtcaaaaagaattagaaatggtgttaaaagaa
aaaggtaaatctgaattactagagaaagttcagtattcaacggaacttgcgaatattttt
tatgtaaggcagaaagaacaaaaaggtttagggcatgcgattagttctgcgcgtcaattt
atcggcaatgaaccatttgcggtattattaggtgacgatattgttgaatctgaagtgcca
gcagtgaaacagttgattgacgtttatgaagaaacagggcactcagttataggtgtccaa
gaagttccggaagcagatactcatcgttatggaattattgacccattaactaaaaacgga
cgtcagtatgaagtgaaaaagtttgttgaaaagccagcacaaggtacggcaccatcaaac
ctagctattatgggacgttatgtattaacgcctgaaattttcgattatttaaaaacgcaa
aaagaaggcgcaggtaacgaaattcagttaacagatgcgattgaacgtatgaataatgat
aaccaagtgtatgcatatgacttcgaaggcgaacgttatgacgttggagaaaaattaggc
ttcgttaaaactaccatagaatatgcattgaaagatgacagtatgcgagaagaattaaca
cgatttattaaagcattaggtttataa

DBGET integrated database retrieval system