KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_2526Help
Entry
NWMN_2526         CDS       T00557                                 

Gene name
phoB
Definition
alkaline phosphatase III precursor
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sae00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:sae00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sae02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2777169..2778593
Genome map
AA seq 474 aa AA seqDB search
MLSVKKATKFAVANLIIVSTVFSSVTPAIAQSDKSSKDESFAVGNTKNPKNVIFLVGDGM
GPSFNTAYRYYKNDPHAKEMTPTAFDSYLKGTNRTYSNDPKQNITDSAAGGTAFSSGHKT
YNGAIGVDSNKQKVKTVLERAKEKGKSTGLVSTAELTDATPAAYAAHVTSRDDKNEIAKQ
FYKDKINGKHKVDVLLGGGAKYFGKSNGNLDKKFKKDGYDLATNSKELSKSDKDKVLGLF
ADKNMPLAIDASKDEPSLADMQQSALSKLERNKKGFFLMVEGASIDKSAHSNDITGVMSE
MEGFEKAFDDAIQYAKKHKDTLVVATADHSTGGLTIGKDKGYEWNPQPIKSMKHSGSYMT
EKMAKGEDPEKVINEGYGFEFSQDDMKKVKKENKKLKRLLKKEKDEKSAEVETQTKALQH
AIQKPVNDKSYTGWTSDGHTGEDVNTYAYGPRSESFSGNIENTESAKIIFDIFK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgttatcagttaaaaaagccacaaaatttgcagttgctaaccttattatcgtgtcaacg
gtttttagttctgtcacacctgcaattgcgcaatccgataaaagttctaaagatgaaagt
ttcgcggttggtaatactaaaaatccaaaaaatgttatctttttagttggcgatggcatg
ggtccatcatttaacacagcttatcgttattataaaaatgatccgcatgctaaagaaatg
acccctactgcttttgattcatatttaaaaggcacaaatcgtacatattcaaatgaccca
aaacagaatattactgattctgcagctggcggaacagcctttagttctggtcataagaca
tataatggtgccatcggtgttgacagtaacaagcagaaagtaaagacggtgcttgaacgt
gcaaaagaaaaaggtaagtcgactggtcttgtttcaacagctgaattaacagatgcaaca
ccagcagcatatgctgcacacgtgacttctagagatgataaaaacgaaatcgctaaacaa
ttttataaagataaaatcaacggaaagcataaagttgatgttttattaggcggcggcgct
aaatatttcggtaaaagtaatggcaatttagataaaaaattcaaaaaagatggttacgac
cttgccacgaacagtaaggagttatcaaaatctgataaagataaagttcttggtttgttt
gcagataaaaatatgccacttgcaatagatgcttctaaagacgaaccatcattagctgat
atgcaacaaagtgcacttagtaagcttgagcgcaataaaaaaggattctttttaatggtc
gaaggtgcttctatagataaatcagcgcattccaacgatattacaggcgttatgtctgaa
atggaaggttttgaaaaagcattcgatgacgccattcaatatgctaagaaacataaagat
acacttgtcgttgcaacagcagatcactctactggtggtctaacaattggtaaagataaa
ggatacgaatggaatcctcaaccgattaaatctatgaaacactctggatcatatatgaca
gaaaaaatggctaaaggtgaagaccctgaaaaagttattaatgaaggttatggatttgaa
ttttcacaagatgatatgaaaaaggttaaaaaagagaataaaaagctaaaaagactactt
aaaaaagaaaaagacgaaaaatccgcagaagtagaaacgcaaacaaaagccctacaacac
gctattcagaagccagtaaatgataaatcttatacagggtggacttccgatggacataca
ggcgaggatgttaatacctacgcttacggacctagatcagaatcatttagtggtaatatc
gaaaatacagaaagcgcaaaaataatatttgatatattcaagtaa

DBGET integrated database retrieval system