KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_2576Help
Entry
NWMN_2576         CDS       T00557                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase HisD
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Pathway
sae00340  Histidine metabolism
sae01100  Metabolic pathways
sae01110  Biosynthesis of secondary metabolites
sae01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sae00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    NWMN_2576 (hisD)
Enzymes [BR:sae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     NWMN_2576 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh HALZ DUF4435 MbeB_N DUF883 FadA
Motif
Other DBs
NCBI-ProteinID: BAF68848
UniProt: A0A0H3KAR9
Position
complement(2843940..2845190)
Genome map
AA seq 416 aa AA seqDB search
MLNAQQFLNQFSLEAPLDESLYPIIRDICQEVKVHGDKALKMYNLTFDHTKTDHLEISHE
QIKAAFDTLDEKTKQALQQSYERIKAYQESIKQTNQQLEESVECYEIYHPLESVGIYVPG
GKASYPSTVLMTATLAQVAGVENIVVVTPPQPNGVSQEVLAACYITQVDQVFQVGGAQSI
AALTYGTETIPKVDKIVGPGNQFVAYAKKYLFGQVGIDQIAGPTEIALIIDETADLDAIV
YDVFAQAEHDELARTYAISEDAQVLKDLESRIAKALPNVDRYDIVSKSIANQHYLIHASN
FDEACHVMNTIAPEHASIQTVNPQPYIEKVKYVGALFIGHYSPEVIGDYVAGPSHVLPTN
RTARFTNGLSVNDFLTRNTVIHLSKDTFEQIADSAQHIAHVEALYNHQQSILIRQS
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatgcacaacaatttttaaatcaattttcattagaagcaccattagatgagtca
ttgtatccaattattcgcgatatttgtcaggaagttaaagttcatggagataaggctttg
aaaatgtataatctaacattcgatcatacgaaaacagatcatttagaaattagtcatgaa
caaattaaagcagcatttgacacattagatgaaaaaacaaaacaagcattacaacaaagt
tatgaaagaattaaagcatatcaagaaagtattaaacagacgaatcaacagttagaagaa
tcagtggagtgttatgaaatataccatccactagaaagtgtcggtatttatgtgcctggt
ggtaaagcaagttatccttcaacggtattaatgacagcgacgttagcacaagtagcaggt
gtggaaaatattgtcgttgtgacaccacctcaacctaatggtgtgtctcaagaagtatta
gcagcatgctatattacgcaagttgatcaagtatttcaagttggtggtgctcaaagtatt
gctgcgttaacttatggcacagaaacgatacctaaagttgataagattgtaggtccaggc
aatcaatttgttgcatatgccaagaaatatttatttggacaagtaggtattgaccaaata
gctggaccaacagaaatagcacttattattgatgaaacagcagatttagatgccatcgta
tatgatgtttttgcacaagcagaacatgatgaattagcacgtacatatgccattagtgaa
gatgcgcaagtccttaaagatttagaatcacgtattgctaaagcattgcctaatgtggac
agatacgacattgtttctaaaagtatcgctaatcaacactaccttatccatgctagtaat
tttgatgaagcatgccatgtcatgaatacaatcgcgcctgaacatgcgtcgattcaaaca
gtaaatcctcaaccatatattgaaaaagtgaaatatgtgggtgcattgtttattggacat
tattcgccagaggtcataggagattacgttgcaggtccaagtcatgtattacctacaaat
agaacagctagatttaccaatgggttatcggtcaatgatttcttaacacggaacacggtc
atccatttatcaaaagatacgtttgaacaaattgctgattcagcacaacatattgctcat
gttgaagcattatacaatcaccagcagtctattttaatacgtcagtcttag

DBGET integrated database retrieval system