KEGG   Sulfurihydrogenibium azorense: SULAZ_0103Help
Entry
SULAZ_0103        CDS       T00876                                 

Definition
cytochrome C551 peroxidase (cytochrome Cperoxidase) (CCP) (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
saf  Sulfurihydrogenibium azorense
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
90664..91725
Genome map
AA seq 353 aa AA seqDB search
MKKLSIMALSALVAVGSIAGYTVAQQKINDKDLLNQAKNYFQPLPKEIPAPSDNPTTKEK
VQLGKMLYYDPRLSLSGVISCNTCHNLATYGVDGVETSLGHKFQTGGKNAPTVLNAGFHI
AQFWDGRAKTLEDQAKGPVLNPVEMSMPDPNLVIERLKTIEGYVAEFKKAFPNEKDPVNY
DNVAKAIAAFERTLVTPSRFDEFLKGNTKALTQKEKEGLKLFMEKGCASCHNGVAIGGTM
FQKFGVVKPYPYQDTNDLGRYNVTKNEADKYVYKVPSLRNVTRTYPYFHDGKVWDIREAV
KIMGETQLGITLTDDEIDKIVAFLDSTTGKIPEDALKMPVLPPSSPKTPKPRI
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagttgtccataatggctttgtctgccttagtagctgttggttcaatagcagga
tacaccgtagcacagcagaaaattaacgacaaagaccttttaaaccaagcaaaaaactac
ttccaaccactacctaaagaaattccagctccttctgacaaccctacaactaaagaaaaa
gttcagcttggtaaaatgctctactacgacccaagactatctttaagtggtgttatcagc
tgtaatacttgccacaacttagcaacttacggagttgatggagttgagacatctttagga
cataagttccaaacaggtggtaaaaacgctccaacagttttaaatgcaggcttccatata
gctcaattctgggatggaagagctaagactctcgaagaccaagcaaaaggaccagtactc
aatcctgttgagatgtcaatgccggaccctaaccttgtgatagagagattaaaaactata
gaaggttatgtagcagagtttaaaaaggcatttcctaatgaaaaagaccctgttaactat
gataacgtagcaaaagcaatagctgctttcgaaagaaccttagtaacaccttcaagattt
gatgaatttttaaaaggtaatacaaaggctttaactcaaaaagagaaagaaggtttaaaa
cttttcatggaaaagggatgtgcttcttgtcataatggagtggctataggtggaactatg
ttccaaaaattcggtgtagttaaaccttatccataccaagacactaacgatttaggaagg
tacaacgtaactaaaaacgaagctgataagtatgtttacaaagtgccttctttaagaaac
gtaacaagaacatatccttacttccacgatggaaaggtatgggatataagagaagctgtt
aagataatgggagaaactcaacttggaataacgttaactgatgatgaaatagataagatt
gttgcattcttagactctacaactggtaaaatcccagaagatgcattaaaaatgccagta
ttaccaccatcttctccaaaaacaccaaaaccaagaatataa

DBGET integrated database retrieval system