KEGG   Sulfurihydrogenibium azorense: SULAZ_0363Help
Entry
SULAZ_0363        CDS       T00876                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:saf00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:saf00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
328025..328594
Genome map
AA seq 189 aa AA seqDB search
MPFEFIKTEIPEVLIVKPKVFSDDRGFFLEFYKESEFKAAGIDTNFVQDNHSKSVKGVLR
GLHYQLNPKAQGKLVRCIKGKIFDVAVDIRKKSPTFGKYVAVELSEENKLMLWIPKGFAH
GFLVLSEEAEIIYKVSGSEYSPEHDRAIRWNDPDINIKWPIDTYPILSQKDEKAPFLKDA
EINFIYGED
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgccctttgagtttataaaaacagagattccagaagttttaattgttaaaccaaaagtt
ttttcagacgatagaggattttttctagaattttacaaagaatcagagtttaaagcagca
ggaatagatacaaattttgtacaagataaccactcaaaatcagtaaaaggagttttaaga
ggattacattaccagttaaatccaaaagctcaaggtaagttagtaagatgtataaaaggt
aaaatttttgatgtggctgtagatataaggaaaaaaagtcctacctttggaaaatatgtt
gctgtagaattatccgaagaaaataaattaatgctttggataccaaaaggatttgctcac
ggatttttagttttatctgaagaagctgagattatatacaaagtatcaggatcagaatac
tcacctgaacacgacagagctataagatggaatgaccctgatataaatataaaatggcct
atagatacttatcctatattatcacaaaaagatgaaaaagcaccatttttaaaagatgca
gaaataaattttatatatggagaggattga

DBGET integrated database retrieval system