KEGG   Sulfurihydrogenibium azorense: SULAZ_0382Help
Entry
SULAZ_0382        CDS       T00876                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:saf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SULAZ_0382 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SULAZ_0382 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SULAZ_0382 (trpA)
Enzymes [BR:saf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SULAZ_0382 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
346359..347126
Genome map
AA seq 255 aa AA seqDB search
MIKEIFQSRKPLICYFMAGYPSVEDSIKTAFTLIENGADILEVGFPFSDPVADGVTIQVA
HEKAVKDGITPEKVFQITKTIKEKYPNVPLIGMTYYNPIFRFGEENFCNRAKESGIDGFI
VPDLPPEEGGNLKKVANRKGLSLIFLLAPTSNEERIKLVSKMSDDFIYYVSLTGITGERD
TLPWDELKEKITLIRKITDKKIAVGFGVSKGEHAKIISQIADGVIVGSSVVKLQGKRDFE
GLKNLVKELKSNIEA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgataaaagagatttttcaaagtagaaaacctcttatctgctactttatggcaggatac
ccatctgtagaagacagtattaaaacagcatttactttaatagaaaatggagctgatata
cttgaagtaggatttccattctctgaccctgttgcagatggcgtaacaattcaagtagcc
catgaaaaagccgtaaaagacggtatcacacctgaaaaagtatttcaaatcactaaaacc
attaaagaaaagtacccaaacgtacctttaataggaatgacttactacaacccaatattt
agatttggagaagaaaacttttgcaatagagcaaaagaaagtggaatagatggttttata
gttccagacctgccaccagaagaaggaggaaatttaaaaaaagtagcaaaccgtaaagga
ttatctttaatattcttacttgcacctacttctaacgaagaaaggataaaacttgtgtca
aaaatgagtgatgattttatatactatgtttcattaacaggaataacaggagaaagggat
actcttccttgggacgaacttaaagaaaaaataactttaataagaaaaataacagataaa
aaaattgctgttggttttggagtctctaagggagaacatgcaaagattatatctcagata
gcagatggagttatagttggtagtagtgtcgtaaaacttcaaggtaaaagagattttgaa
ggacttaaaaatttggtaaaagagttaaagtcaaacatagaggcgtag

DBGET integrated database retrieval system