KEGG   Sulfurihydrogenibium azorense: SULAZ_0428Help
Entry
SULAZ_0428        CDS       T00876                                 

Definition
bifunctional protein fold protein (EC:1.5.1.5 3.5.4.9)
Orthology
K01491  
methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
One carbon pool by folate
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:saf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SULAZ_0428
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SULAZ_0428
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SULAZ_0428
Enzymes [BR:saf01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     SULAZ_0428
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     SULAZ_0428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
385323..386177
Genome map
AA seq 284 aa AA seqDB search
MILLNGKELAEKIKNQIKQELQEFLNKGYRRPTLAVILVGENPASQIYVNKKIKDCQSVG
INSKPFFLPENITQIELLDLIGQLNGDEEVDGILVQLPLPSHINTLEIIEAINPKKDVDG
FHPLNVGKLATGRNDGIIPCTPYGIMKLLEYYNIDTFGKDVVVVGASNIVGKPMSLLFLK
DEKSTVTICHKNTKDLKSHTLKADILVVAVGKPKLITADMVKEGAVVIDVGINRVDGKIV
GDVDFENVSKKVSAITPVPGGVGPMTVAMLLYNTFQAYKNNVIS
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgattcttttaaatggaaaggagttagctgaaaagattaaaaaccagataaagcaagaa
ttacaagagtttttaaataaaggctacagaagacctactttagctgttatacttgtggga
gaaaatcctgcaagtcagatatacgttaataaaaagattaaagactgtcagtctgttgga
ataaactctaaacccttcttcttgccagagaacataactcagatagaacttttagacctt
ataggacagcttaacggagatgaggaagttgacggaattttagttcagctccctcttcct
tctcatataaacactttagagataatagaagctataaatccaaaaaaagacgttgatggt
tttcatcctcttaatgtaggaaaacttgcaactggaagaaatgatggtataatcccttgc
actccttacggtataatgaaactccttgagtactacaatatagacacttttggaaaggat
gttgtagtagtaggggcaagtaatatagtaggaaagcctatgtccttgctgtttttaaaa
gatgaaaaatctactgttactatatgtcataaaaatacgaaagatttaaaatcccacaca
ttaaaagcagatattcttgtggttgctgtaggtaaacctaaacttataactgcagatatg
gttaaagaaggagcagttgtcatagatgtaggtataaacagggttgatggtaaaatagtt
ggagacgtagactttgaaaatgtaagtaaaaaagtatcagccataacacctgttcccggt
ggtgttggtcctatgactgttgctatgctactttataacacttttcaggcttataaaaat
aacgttatttcttag

DBGET integrated database retrieval system