KEGG   Sulfurihydrogenibium azorense: SULAZ_0428Help
Entry
SULAZ_0428        CDS       T00876                                 

Definition
bifunctional protein fold protein (EC:1.5.1.5 3.5.4.9)
Orthology
K01491  
methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
One carbon pool by folate
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:saf01200]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:saf00720]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:saf00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
385323..386177
Genome map
AA seq 284 aa AA seqDB search
MILLNGKELAEKIKNQIKQELQEFLNKGYRRPTLAVILVGENPASQIYVNKKIKDCQSVG
INSKPFFLPENITQIELLDLIGQLNGDEEVDGILVQLPLPSHINTLEIIEAINPKKDVDG
FHPLNVGKLATGRNDGIIPCTPYGIMKLLEYYNIDTFGKDVVVVGASNIVGKPMSLLFLK
DEKSTVTICHKNTKDLKSHTLKADILVVAVGKPKLITADMVKEGAVVIDVGINRVDGKIV
GDVDFENVSKKVSAITPVPGGVGPMTVAMLLYNTFQAYKNNVIS
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgattcttttaaatggaaaggagttagctgaaaagattaaaaaccagataaagcaagaa
ttacaagagtttttaaataaaggctacagaagacctactttagctgttatacttgtggga
gaaaatcctgcaagtcagatatacgttaataaaaagattaaagactgtcagtctgttgga
ataaactctaaacccttcttcttgccagagaacataactcagatagaacttttagacctt
ataggacagcttaacggagatgaggaagttgacggaattttagttcagctccctcttcct
tctcatataaacactttagagataatagaagctataaatccaaaaaaagacgttgatggt
tttcatcctcttaatgtaggaaaacttgcaactggaagaaatgatggtataatcccttgc
actccttacggtataatgaaactccttgagtactacaatatagacacttttggaaaggat
gttgtagtagtaggggcaagtaatatagtaggaaagcctatgtccttgctgtttttaaaa
gatgaaaaatctactgttactatatgtcataaaaatacgaaagatttaaaatcccacaca
ttaaaagcagatattcttgtggttgctgtaggtaaacctaaacttataactgcagatatg
gttaaagaaggagcagttgtcatagatgtaggtataaacagggttgatggtaaaatagtt
ggagacgtagactttgaaaatgtaagtaaaaaagtatcagccataacacctgttcccggt
ggtgttggtcctatgactgttgctatgctactttataacacttttcaggcttataaaaat
aacgttatttcttag

DBGET integrated database retrieval system