KEGG   Sulfurihydrogenibium azorense: SULAZ_0428Help
Entry
SULAZ_0428        CDS       T00876                                 

Definition
(GenBank) bifunctional protein fold protein
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
saf00670  One carbon pool by folate
saf00720  Carbon fixation pathways in prokaryotes
saf01100  Metabolic pathways
saf01120  Microbial metabolism in diverse environments
saf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:saf00001]
 Metabolism
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SULAZ_0428
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SULAZ_0428
Enzymes [BR:saf01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     SULAZ_0428
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     SULAZ_0428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH AlaDh_PNT_C Sacchrp_dh_NADP NLE
Motif
Other DBs
NCBI-ProteinID: ACN98777
UniProt: C1DTI2
Position
385323..386177
Genome map
AA seq 284 aa AA seqDB search
MILLNGKELAEKIKNQIKQELQEFLNKGYRRPTLAVILVGENPASQIYVNKKIKDCQSVG
INSKPFFLPENITQIELLDLIGQLNGDEEVDGILVQLPLPSHINTLEIIEAINPKKDVDG
FHPLNVGKLATGRNDGIIPCTPYGIMKLLEYYNIDTFGKDVVVVGASNIVGKPMSLLFLK
DEKSTVTICHKNTKDLKSHTLKADILVVAVGKPKLITADMVKEGAVVIDVGINRVDGKIV
GDVDFENVSKKVSAITPVPGGVGPMTVAMLLYNTFQAYKNNVIS
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgattcttttaaatggaaaggagttagctgaaaagattaaaaaccagataaagcaagaa
ttacaagagtttttaaataaaggctacagaagacctactttagctgttatacttgtggga
gaaaatcctgcaagtcagatatacgttaataaaaagattaaagactgtcagtctgttgga
ataaactctaaacccttcttcttgccagagaacataactcagatagaacttttagacctt
ataggacagcttaacggagatgaggaagttgacggaattttagttcagctccctcttcct
tctcatataaacactttagagataatagaagctataaatccaaaaaaagacgttgatggt
tttcatcctcttaatgtaggaaaacttgcaactggaagaaatgatggtataatcccttgc
actccttacggtataatgaaactccttgagtactacaatatagacacttttggaaaggat
gttgtagtagtaggggcaagtaatatagtaggaaagcctatgtccttgctgtttttaaaa
gatgaaaaatctactgttactatatgtcataaaaatacgaaagatttaaaatcccacaca
ttaaaagcagatattcttgtggttgctgtaggtaaacctaaacttataactgcagatatg
gttaaagaaggagcagttgtcatagatgtaggtataaacagggttgatggtaaaatagtt
ggagacgtagactttgaaaatgtaagtaaaaaagtatcagccataacacctgttcccggt
ggtgttggtcctatgactgttgctatgctactttataacacttttcaggcttataaaaat
aacgttatttcttag

DBGET integrated database retrieval system