KEGG   Sulfurihydrogenibium azorense: SULAZ_0449Help
Entry
SULAZ_0449        CDS       T00876                                 

Definition
(GenBank) signal transduction response regulator
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
saf  Sulfurihydrogenibium azorense
Brite
Enzymes [BR:saf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     SULAZ_0449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
401410..402225
Genome map
AA seq 271 aa AA seqDB search
MGDCMKKNFNIGKEEKFFEINIRETSDKLEKIADSIEEKLLDILNVAYLHKENIQKHEEI
TKKSDDEKFSKILQELEFIKNQNESLTKKLENYHKEIQNLNMELKIAKQDATIDFLTGVV
NRRSFDRTLGNLLKEVREKDYIFTLILLDIDNFKSVNDTYGHLAGDLVLKEISTVLRIFL
RANTIIGRIGGEEFGIILPGVSLENGIKVAERIRSIIENREVKFEDRIIKFTASFGVTES
KKEDTKESIYKRVDEALYIAKRNGKNRVAFL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgggcgattgtatgaaaaaaaattttaatattggcaaagaagaaaaattttttgaaata
aacataagagaaacatcagataaattggaaaaaatagcagacagcatagaagaaaaactc
cttgatatattaaacgttgcttacttacataaggaaaacatacagaagcatgaggagatt
accaaaaagtcagatgacgaaaaattttctaagattctacaagaacttgaatttataaaa
aatcagaatgaaagtttaacaaagaagttagaaaattaccataaagaaattcaaaatctg
aacatggaactaaaaattgcaaaacaagacgcaactattgatttcttaacaggtgttgta
aatcgtagaagttttgacagaacattggggaatttgttaaaagaagtaagggaaaaggat
tatatctttacgttaatcttattagatattgataattttaaatctgttaacgatacttat
ggacatttggctggtgatttagttttgaaagagatttctactgttttaagaatcttttta
agggctaatacaataattggaaggataggaggagaagagtttggaataatcttacctgga
gtgtctttagaaaatggaataaaagtagctgaaagaataagaagtattattgaaaataga
gaagtaaaatttgaagatagaataataaaatttactgccagttttggcgtaacagaaagt
aaaaaagaagatacaaaagaatcaatatataagagagtagatgaagcactttatattgct
aaaagaaatgggaaaaatagagtagcctttttataa

DBGET integrated database retrieval system