KEGG   Sulfurihydrogenibium azorense: SULAZ_0486Help
Entry
SULAZ_0486        CDS       T00876                                 

Gene name
thrC_1
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:saf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SULAZ_0486 (thrC_1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SULAZ_0486 (thrC_1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SULAZ_0486 (thrC_1)
Enzymes [BR:saf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SULAZ_0486 (thrC_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
436366..437598
Genome map
AA seq 410 aa AA seqDB search
MAKVKGLKCKECGTEYPVEPIHVCEFCFGPLEIVYDYQEIKKNISKEKIEKGPKSLWRYV
DLLPVDNPTVGLSAGFTPLIKAENLGKALGLNNLYIKDDSVNHPTLSFKDRVVAVALSKA
KEFGFDTAACASTGNLANSVAAHAASAGMKCYVFIPSNLETNKIIGSLVFNPVVVAVDGN
YDDVNRLSSEIANEFGWAFVNINVRPFYSEGSKTLAFEVAEQLGWKIPDTVVAPLASGSL
YTKIWKGFNELIEVGLVEGKPPRMLGAQAEGCSPIYQALKEGRDFIKPVKPNTIAKSIAI
GNPADGPYAVKVAKESGGDIQIATDQEIIEGIKLLAKTEGIFTETAGGTTIAVLKKFAEA
GVFDKDEVVVAYITGNGYKTMEVLEGKLEKPIHIKPSLVEFKEKVINKNQ
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaaagtaaaggggcttaaatgtaaagagtgtggaacagaatacccagttgagcct
attcacgtttgtgagttttgttttggtcctttagagatagtttacgactatcaagaaata
aagaaaaatatatcaaaagagaaaatagaaaaaggtccaaaaagtttatggaggtatgta
gaccttcttcctgtagacaatcctacagtaggtctatctgctggatttacacctttaata
aaagcagagaacctcggaaaagccttaggtttaaacaatctttatataaaggatgactct
gtaaaccatcctactttatcttttaaagatagagttgtggcagttgctttgtctaaagca
aaagaatttggttttgatactgcagcttgtgcatctacaggaaaccttgcaaactctgtt
gcagcccatgcagcttctgctggaatgaaatgttatgtcttcattccttctaaccttgaa
acaaataaaataataggaagtcttgtttttaatcctgttgttgttgcagttgatggtaac
tatgacgatgtaaacagactttcttctgagattgccaacgagtttggttgggcatttgtc
aatataaacgtaagacctttttactctgaaggttcaaaaactcttgcctttgaagttgca
gagcagcttggttggaagatacctgatactgtagtagcacctttagcatctggttcttta
tacactaaaatatggaaaggatttaatgaacttatagaagttggcttagtagaaggaaaa
ccaccaaggatgcttggagctcaagcggaaggttgtagtccaatataccaagcactaaaa
gaaggaagagactttataaagccagtaaaaccaaacacaatagcaaaatctatagctata
ggaaacccagctgacggtccttacgctgtcaaagttgcaaaagaaagtggaggtgacata
cagatagctacagaccaagagattatagaaggaatcaaattacttgcaaaaacagaagga
atattcacagaaacagcaggaggaacaacgatagcagttcttaaaaagtttgctgaggca
ggagtttttgataaagatgaggttgtagttgcttacattacaggaaacggttataaaact
atggaagttttagaaggaaagttagaaaaacctattcacataaaaccatcattagtagag
tttaaagagaaagttataaataaaaatcagtaa

DBGET integrated database retrieval system