KEGG   Sulfurihydrogenibium azorense: SULAZ_0527Help
Entry
SULAZ_0527        CDS       T00876                                 

Definition
ATP-citrate synthase (ATP-citrate (pro-S-)-lyase)(citrate cleavage enzyme) (EC:2.3.3.8)
Orthology
K15231  
ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
Citrate cycle (TCA cycle)
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:saf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SULAZ_0527
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SULAZ_0527
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SULAZ_0527
Enzymes [BR:saf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     SULAZ_0527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
472307..473614
Genome map
AA seq 435 aa AA seqDB search
MAQRGIREYDGKRIIAQNWKDYFGDAFEYDFKSVLVTPETDFEKLPEEHPWLKTTPLVAK
PDMLFGKRGKLGLVLFKINEPGDVTYEDAVKWIKQKMQEEVEINGVKGHLTHFLIEPFVP
HKPEEEYYVAFSMGDDYDTVYMSAFGGIDVEENWDKVSEVKIPPTASDEEIEKLIKQNVP
KEIKDKEKYADFVIRAYKMFRDLHFVYFEINPLVLVGNKAYLLDFVGKVDDTAGFVVGKK
WGELEFPSGFGRDLTPEEKYIKELDEKSGSSLKLTILNPEGRIWTLVAGGGASVVYADTV
ADMGYVNELANYGEYSGNPTRTETREYVKTVLDLMTRNKHPSGKPKILLIGGAIANFTDV
AKTFDGIIDAFKEYAEKMRQVGVRIYVRRGGPNYEVGLKKIKQAAEELGLPIEVYGPELH
MTDIVRKALEEEKVA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggctcagagaggaataagagaatatgatggaaagagaattatagcccaaaactggaaa
gattactttggtgatgcctttgagtacgattttaaatctgtgttagtaactcctgaaaca
gattttgagaaacttcctgaagaacatccttggttaaagaccactcctttggtagcaaaa
ccggacatgctttttggaaaaagaggaaagttaggtttagttttatttaaaatcaacgaa
ccgggagacgttacttacgaagatgcggttaagtggataaaacaaaagatgcaggaagaa
gttgagattaacggtgtaaaggggcatcttacacattttttaatagagccttttgttcct
cacaaaccagaagaagagtactatgtagcattctctatgggtgatgattacgatactgtt
tacatgtcagcctttggtggaatagatgttgaagagaactgggataaagtttctgaagta
aaaatacctcctacagcttcagatgaagagatagaaaaacttataaaacaaaacgttcca
aaagagataaaagataaagaaaaatacgcagattttgtaattagagcttataaaatgttt
agagacttacattttgtttactttgaaataaacccattggttttagttggaaataaggct
tacctattagactttgttggtaaagttgacgatactgcaggatttgttgttggcaaaaaa
tggggagagcttgagtttccgtctgggtttggaagagatctaacaccagaggaaaagtat
ataaaagagttagatgaaaaatctggttcttctctaaagttaacgatactcaatccagaa
ggaagaatatggacattagtagcaggtggtggagcttctgttgtttatgctgatacagta
gcagatatgggatatgttaacgagcttgcaaactacggtgagtattcaggaaacccaaca
agaacagaaaccagagagtatgtaaaaacagttttagaccttatgacaagaaacaaacat
ccatctggaaaacctaaaatacttttaataggtggagcgatagctaactttacagatgtt
gccaaaacctttgatggaataatagatgcatttaaagagtacgcagaaaaaatgaggcaa
gtgggagtaagaatttacgtaagaagaggtggacctaactacgaagtgggacttaaaaaa
attaaacaggcagctgaagaacttggactaccaatagaagtttatggtccagaacttcat
atgacagatatagtaagaaaagcgttagaagaagaaaaagtagcataa

DBGET integrated database retrieval system