KEGG   Sulfurihydrogenibium azorense: SULAZ_0527Help
Entry
SULAZ_0527        CDS       T00876                                 

Definition
ATP-citrate synthase (ATP-citrate (pro-S-)-lyase)(citrate cleavage enzyme) (EC:2.3.3.8)
Orthology
K15231  
ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
Citrate cycle (TCA cycle)
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:saf01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:saf00020]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:saf00720]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
472307..473614
Genome map
AA seq 435 aa AA seqDB search
MAQRGIREYDGKRIIAQNWKDYFGDAFEYDFKSVLVTPETDFEKLPEEHPWLKTTPLVAK
PDMLFGKRGKLGLVLFKINEPGDVTYEDAVKWIKQKMQEEVEINGVKGHLTHFLIEPFVP
HKPEEEYYVAFSMGDDYDTVYMSAFGGIDVEENWDKVSEVKIPPTASDEEIEKLIKQNVP
KEIKDKEKYADFVIRAYKMFRDLHFVYFEINPLVLVGNKAYLLDFVGKVDDTAGFVVGKK
WGELEFPSGFGRDLTPEEKYIKELDEKSGSSLKLTILNPEGRIWTLVAGGGASVVYADTV
ADMGYVNELANYGEYSGNPTRTETREYVKTVLDLMTRNKHPSGKPKILLIGGAIANFTDV
AKTFDGIIDAFKEYAEKMRQVGVRIYVRRGGPNYEVGLKKIKQAAEELGLPIEVYGPELH
MTDIVRKALEEEKVA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggctcagagaggaataagagaatatgatggaaagagaattatagcccaaaactggaaa
gattactttggtgatgcctttgagtacgattttaaatctgtgttagtaactcctgaaaca
gattttgagaaacttcctgaagaacatccttggttaaagaccactcctttggtagcaaaa
ccggacatgctttttggaaaaagaggaaagttaggtttagttttatttaaaatcaacgaa
ccgggagacgttacttacgaagatgcggttaagtggataaaacaaaagatgcaggaagaa
gttgagattaacggtgtaaaggggcatcttacacattttttaatagagccttttgttcct
cacaaaccagaagaagagtactatgtagcattctctatgggtgatgattacgatactgtt
tacatgtcagcctttggtggaatagatgttgaagagaactgggataaagtttctgaagta
aaaatacctcctacagcttcagatgaagagatagaaaaacttataaaacaaaacgttcca
aaagagataaaagataaagaaaaatacgcagattttgtaattagagcttataaaatgttt
agagacttacattttgtttactttgaaataaacccattggttttagttggaaataaggct
tacctattagactttgttggtaaagttgacgatactgcaggatttgttgttggcaaaaaa
tggggagagcttgagtttccgtctgggtttggaagagatctaacaccagaggaaaagtat
ataaaagagttagatgaaaaatctggttcttctctaaagttaacgatactcaatccagaa
ggaagaatatggacattagtagcaggtggtggagcttctgttgtttatgctgatacagta
gcagatatgggatatgttaacgagcttgcaaactacggtgagtattcaggaaacccaaca
agaacagaaaccagagagtatgtaaaaacagttttagaccttatgacaagaaacaaacat
ccatctggaaaacctaaaatacttttaataggtggagcgatagctaactttacagatgtt
gccaaaacctttgatggaataatagatgcatttaaagagtacgcagaaaaaatgaggcaa
gtgggagtaagaatttacgtaagaagaggtggacctaactacgaagtgggacttaaaaaa
attaaacaggcagctgaagaacttggactaccaatagaagtttatggtccagaacttcat
atgacagatatagtaagaaaagcgttagaagaagaaaaagtagcataa

DBGET integrated database retrieval system