KEGG   Sulfurihydrogenibium azorense: SULAZ_0638Help
Entry
SULAZ_0638        CDS       T00876                                 

Definition
(GenBank) succinyl-CoA synthetase beta chain (SCS-alpha)(Vegetative protein 63) (VEG63)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
saf00020  Citrate cycle (TCA cycle)
saf00640  Propanoate metabolism
saf00660  C5-Branched dibasic acid metabolism
saf00720  Carbon fixation pathways in prokaryotes
saf01100  Metabolic pathways
saf01110  Biosynthesis of secondary metabolites
saf01120  Microbial metabolism in diverse environments
saf01130  Biosynthesis of antibiotics
saf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:saf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SULAZ_0638
   00640 Propanoate metabolism
    SULAZ_0638
   00660 C5-Branched dibasic acid metabolism
    SULAZ_0638
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SULAZ_0638
Enzymes [BR:saf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SULAZ_0638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 Succ_CoA_lig GARS_A Citrate_bind ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ACN99701
UniProt: C1DU36
Position
573698..574864
Genome map
AA seq 388 aa AA seqDB search
MKVHEHQAKEIFRKYGLPVPRGYPAFDVKEAVEAAEELGTWPVVVKAQIHAGGRGKAGGV
KLAKSIEEVQQIAAELLGKKLVTFQTGPEGLPVSRLYIEEGTAIDKEYYVAITLDRSKSK
PIIMVSAAGGMEIEEVAATNPEAIITHTIEPFIGLRSYHARELALKLGLPKNLLNKAANL
FMTLYKIYIELDASMVEINPLVLTKDGNLVILDAKIDFDDNGLFRHPEIMEMDDPTQISP
LEVEAKKFNLNYIKLDGNIACMVNGAGLAMSTMDTIKLAGGEPANFLDVGGSANATQIAN
AFKIILSDPNVKAIFINIFGGILRCDRLAEGIITAAKEVSINVPVIVRMEGTNVELGKKM
LQESGLPLITADTMWEGALKAVEAANKG
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtacatgaacatcaggcaaaagaaatctttagaaagtatggccttccagtacca
agaggttatccagcttttgatgtaaaagaagcagtagaggcagctgaagagcttggaact
tggcctgtagttgtaaaagctcaaatccacgcaggtggaagaggtaaagctggcggtgta
aaacttgctaaatccatagaagaagtacaacaaatagcagctgagcttttagggaaaaag
ttagttacattccagacaggtcctgaaggtttaccagtaagcagactatacatagaggaa
ggaacagctattgataaagagtattacgtagctatcacgttagatagaagtaaatcaaaa
cctataataatggtttcagctgccggtggaatggaaattgaagaagttgcagcaacaaac
ccagaagctataataacccatacaatagagccatttataggacttagaagttatcatgca
agagagttagcattaaagttaggacttcctaagaaccttttaaacaaagcagcaaactta
tttatgactttatacaaaatttacatagaacttgatgcttctatggtagaaattaacccg
ttagtattaacaaaagacggtaatttagtaattttagacgcaaaaatagactttgatgat
aacggattgtttagacatccagaaataatggagatggatgacccaacccaaatatctccg
ttagaagtagaagctaaaaagtttaaccttaactacataaaacttgatggaaacatcgct
tgtatggttaatggtgcaggacttgcaatgtcaactatggatactataaagttggcagga
ggagaaccggctaacttccttgatgttggtgggtctgcaaacgcaacacagatagcgaac
gcatttaaaataatactctctgaccctaacgtaaaggctatatttataaacatatttggt
ggaattttaagatgtgatagacttgcagaaggtatcattacagctgcaaaagaagtatct
ataaacgtacctgttatagtaagaatggaaggaacaaatgtagaattaggtaaaaagatg
cttcaagagtctggtttaccacttataactgctgatacaatgtgggaaggagccctaaaa
gcagtagaggctgcaaacaaaggttaa

DBGET integrated database retrieval system