KEGG   Sulfurihydrogenibium azorense: SULAZ_0642Help
Entry
SULAZ_0642        CDS       T00876                                 

Definition
(GenBank) subunit of 2-oxoglutarate:ferredoxin oxidoredutase
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
saf00010  Glycolysis / Gluconeogenesis
saf00020  Citrate cycle (TCA cycle)
saf00620  Pyruvate metabolism
saf00633  Nitrotoluene degradation
saf00640  Propanoate metabolism
saf00650  Butanoate metabolism
saf00680  Methane metabolism
saf00720  Carbon fixation pathways in prokaryotes
saf01100  Metabolic pathways
saf01120  Microbial metabolism in diverse environments
saf01130  Biosynthesis of antibiotics
saf01200  Carbon metabolism
Module
saf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:saf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SULAZ_0642
   00020 Citrate cycle (TCA cycle)
    SULAZ_0642
   00620 Pyruvate metabolism
    SULAZ_0642
   00640 Propanoate metabolism
    SULAZ_0642
   00650 Butanoate metabolism
    SULAZ_0642
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SULAZ_0642
   00680 Methane metabolism
    SULAZ_0642
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    SULAZ_0642
Enzymes [BR:saf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     SULAZ_0642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: ACN98501
UniProt: C1DU40
Position
576797..577966
Genome map
AA seq 389 aa AA seqDB search
MPEQKVVDTDYLLLEAPRERKFITGAQAMAEAVKRANVDMAIAYPITPQSEVMHLVGDLW
AQGYLKDYYRAEEEYGAFSAIAGAARGGARVFTATSGPGLLRGLEAIVSWPGHRVPAVLG
VLTRVVNAPLSIQPDNIEISYLLNCGAVVLHAENQQDVFDFTLAAFAIAEMVDVYIPVAV
ATEGFFVTHAKGYVDLPPEDMKLPDKNPYKSPVPPTDCEIPPARIQRDAPVQKSNFMSYL
IHAVWQQEIWSSNARAMKYIYKYLKGPIEVINPDAEVFVVASGCAAAQAREAVRYSQLEG
LNVGLVKVKSIRPFPEKEIREVLKNAKGIVIPEHNIVGWLAREVRSVIPNNDRVVNGPRV
YGGMTLPTELILDEIYKILGIKKDRKVLV
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgccagaacaaaaagtcgtagatacggattatcttttactagaagctccaagagagcgt
aaattcataactggtgctcaagctatggcagaagctgtaaaaagagccaatgttgatatg
gctatagcatatccaattactccacaatcagaagttatgcacttggttggggacctttgg
gctcaaggatatcttaaagattactatagagcagaagaagagtatggagctttctctgcc
attgcaggagctgcaagaggtggagcaagagtatttacagccacatcaggtccgggattg
ctcagaggtttagaggctatagtttcatggccaggacatagagttccagccgttttaggg
gtattaactagggtagtaaacgctccgctgtcaatacagccagataacattgaaatatcc
tacttattaaactgtggagcagttgtacttcatgcagaaaaccaacaggatgtatttgat
tttacattagcagcttttgcgatagctgaaatggtagatgtttacattcctgtagctgtt
gcaacagaaggtttcttcgttacacacgcaaaaggatacgtagacttaccacctgaagat
atgaaacttccagataaaaatccatataaatctccagttcctcctacagattgtgaaatt
cctcctgcaagaattcaaagagatgctcctgttcaaaaatctaactttatgagctacctt
atacacgcagtatggcagcaagaaatatggtcatctaatgcaagagctatgaaatatata
tacaaatacctcaaaggtccaatagaagttataaacccggatgcagaagtgtttgttgta
gcttcaggatgtgcagctgctcaagcaagagaagcagttagatattcacagttagaaggt
ctaaatgttggtcttgttaaagttaagtctataagaccattccctgaaaaagaaattaga
gaagttttaaagaatgctaaaggaatagttataccagagcataacattgtaggttggtta
gctagagaagttagatctgtaataccaaataatgacagagtagtaaacgggccaagagtt
tacggtggaatgactttaccaacagagttaatacttgatgaaatttataagatacttggt
attaagaaagatagaaaagttttagtttaa

DBGET integrated database retrieval system