KEGG   Sulfurihydrogenibium azorense: SULAZ_0643Help
Entry
SULAZ_0643        CDS       T00876                                 

Definition
subunit of 2-oxoglutarate:ferredoxin oxidoredutase
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:saf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SULAZ_0643
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SULAZ_0643
   00020 Citrate cycle (TCA cycle)
    SULAZ_0643
   00620 Pyruvate metabolism
    SULAZ_0643
   00640 Propanoate metabolism
    SULAZ_0643
   00650 Butanoate metabolism
    SULAZ_0643
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SULAZ_0643
   00680 Methane metabolism
    SULAZ_0643
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    SULAZ_0643
Enzymes [BR:saf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     SULAZ_0643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
577991..578869
Genome map
AA seq 292 aa AA seqDB search
MGLEYVRITTGFEDYMPKDYVDLVKYGQFGKEYDIQELGTFKELLEEHPMCAGCFMAYFV
RVFYASLPNPEDTIVIGTAGCARLALSQAAVPFIYGNYGDTNAVASGLKRALKIRFPDKE
KDVVVVAGDGGLMDIGFGMTMHSWFRRENFTTIMVDNEVYGNTGGQESGMTRKGIQLKMA
PKGKKFDKINVVELAKAAGCVYVARISPTNPKRIAKTIKRAILAARHFGPTFIHAYTSCN
IEYSIPTEKVLEDARKREKEDFAFYEYMTDEVKEYFEQIENKGKQQPSEVKA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgggtttagaatacgtcagaataacaacaggatttgaagattatatgccaaaagactat
gtagatttggtaaagtatggccagttcggaaaagagtatgatattcaagaacttggtaca
ttcaaagagcttcttgaagagcacccaatgtgtgcaggttgctttatggcatattttgta
agagtgttttacgcatctttacctaatccagaagatactatagttataggtactgcaggt
tgtgcaagattagcattgtctcaagcagcagtaccatttatttacggaaattatggagat
actaacgcagttgcttcaggattgaaaagagcattaaaaataagatttcctgacaaagaa
aaagatgttgttgtagtagctggtgatggtggtttaatggatattggttttggtatgacg
atgcattcatggtttagaagagagaactttacaacaataatggtagataacgaggtatac
ggaaacacaggtggacaagaaagtggtatgaccagaaaaggtatccagttaaagatggct
ccaaagggtaagaaatttgataaaataaatgttgtagagcttgctaaagcagctggttgt
gtgtacgtagcaagaatatcacctacaaatccaaagagaattgcaaaaacaattaaaaga
gctatattagcggcgagacattttggtccaactttcattcacgcttacacatcttgtaat
attgaatactctatacctactgaaaaagtacttgaagatgcaagaaaaagagaaaaagaa
gactttgcattctatgaatatatgacggatgaagttaaagaatattttgaacaaatagaa
aacaaagggaaacaacaaccttcagaagtaaaagcttaa

DBGET integrated database retrieval system