KEGG   Sulfurihydrogenibium azorense: SULAZ_0645Help
Entry
SULAZ_0645        CDS       T00876                                 

Definition
hypothetical protein
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:saf01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:saf00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:saf00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:saf00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:saf00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:saf00650]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:saf00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:saf00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:saf00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
579629..579859
Genome map
AA seq 76 aa AA seqDB search
MYYVAETKIDKCSTYKCNQCVLFCPEPNTLMFLDAKNFAYVNQARCKGCAICVYVCGDLL
KRNCIEMVMATVSEAA
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgtactatgttgcagaaactaaaatagataagtgttctacttacaagtgtaaccagtgt
gtacttttctgccctgagccaaatactttaatgtttttagatgctaagaactttgcttat
gttaatcaagcaagatgtaaaggttgtgctatctgtgtatatgtttgcggtgatctatta
aaaagaaactgtatagaaatggtaatggcgacagtaagtgaagctgcataa

DBGET integrated database retrieval system