KEGG   Sulfurihydrogenibium azorense: SULAZ_0656Help
Entry
SULAZ_0656        CDS       T00876                                 

Definition
pyruvate:ferredoxin oxidoreductase subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:saf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SULAZ_0656
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SULAZ_0656
   00020 Citrate cycle (TCA cycle)
    SULAZ_0656
   00620 Pyruvate metabolism
    SULAZ_0656
   00640 Propanoate metabolism
    SULAZ_0656
   00650 Butanoate metabolism
    SULAZ_0656
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SULAZ_0656
   00680 Methane metabolism
    SULAZ_0656
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    SULAZ_0656
Enzymes [BR:saf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     SULAZ_0656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
590573..591433
Genome map
AA seq 286 aa AA seqDB search
MSFKVFQINEEFLDVMPKEIVDLQENATWGNPKRGVMDLPFHKELIEEHSLCAGCPEAAA
LRYIMASIPNPEDTVIVNSTGCTSLVFPHIAMHTVHSLFGNQNAVASGIKRVLEYRYPDK
VKDVIVLAGDGATIDIGLDCTLQSFFRQEKITTICFDNEVYANTGGQESGATPKGHVFKM
APKGKQFEKVPMWQLAIDSGCKYVARLTVSSPKRVESVIKKAVYVAREVGPTYVHLYTPC
ILEIGLNSDQGLEEMRSKDKERFAFFEYISPEAEEVINRKKAEGLL
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttaaagtgtttcaaataaatgaagaatttttagatgtaatgccaaaagagata
gttgatcttcaagagaatgcaacttggggaaatcctaaaaggggagtaatggatcttcct
ttccacaaggagttaattgaagaacactctttgtgtgctggttgccccgaagcagctgct
ttaaggtatattatggcatctatacccaatcctgaagatactgttatagttaactcaaca
ggatgtacttctttggtattccctcacattgcaatgcatacagttcactctcttttcgga
aaccaaaatgctgtagcatctggaataaagagggttttagagtatagataccctgataaa
gttaaagatgttatagtattggcaggtgatggagctactatagatataggattggactgt
acattgcaatctttctttagacaagagaaaattacaactatctgctttgataacgaggtt
tatgcaaacacaggtggacaagagagtggagctacacctaaaggccacgtgtttaaaatg
gctcctaaaggtaagcagtttgaaaaagttccaatgtggcaactggctatagactctggt
tgtaaatatgtagcaaggttgacagtttcttctccaaagagagtagaatccgtaattaaa
aaagctgtatatgtagctagagaagtaggaccaacatatgttcatctttacactccttgt
atacttgaaataggtctcaactctgaccaaggtctagaagagatgagatcaaaggataaa
gaaagattcgctttctttgagtatatatctcctgaagcagaggaagtaattaacaggaaa
aaagcggagggcttactatga

DBGET integrated database retrieval system