KEGG   Sulfurihydrogenibium azorense: SULAZ_0696Help
Entry
SULAZ_0696        CDS       T00876                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SULAZ_0696
Enzymes [BR:saf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     SULAZ_0696
    3.5.1.-  
     SULAZ_0696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
632464..633045
Genome map
AA seq 193 aa AA seqDB search
MKVKLTDKDALIVVDMQNDFMPYGVLPVKDADKIVPTINSYIELFEKMSNPVFFTRDWHP
ENHISFKGFGGIWPAHCVQNTEGAKFHPDLKIPSDNKFIISKGTSPDFDAYSGFQGTNLH
SLLQERGIKRLFICGVATDFCVKNTAIGGLNLGYQVFLLVDAIKSVFPEKEKEVIKDLLD
KTTVALTLKDIDG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtaaagttaactgacaaagatgctttaatagtggttgatatgcaaaacgatttt
atgccttacggcgtccttcctgtaaaagatgcggataagatagtacctactataaacagt
tatattgagctttttgaaaaaatgtcaaaccctgttttttttacaagagactggcatcca
gaaaatcatatatcatttaaaggatttggtggtatatggcctgcccactgtgtccagaac
accgaaggtgcaaaatttcatccagatttaaaaataccatctgataataaatttataatc
tcaaaaggaacaagcccagattttgatgcatactccggatttcaaggtactaacttacac
tctctcttacaagaaagaggtataaaaagactttttatatgtggcgttgcaacagatttc
tgtgtaaaaaatacggctataggtggtttaaacttaggttatcaagttttccttttggtt
gatgcgataaaatctgtatttccagaaaaagagaaagaagttattaaagaccttttagat
aaaactactgtggctttaacattaaaagatatagatggttaa

DBGET integrated database retrieval system