KEGG   Sulfurihydrogenibium azorense: SULAZ_0737Help
Entry
SULAZ_0737        CDS       T00876                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
saf  Sulfurihydrogenibium azorense
Brite
Enzymes [BR:saf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SULAZ_0737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
673019..673801
Genome map
AA seq 260 aa AA seqDB search
MSYKDGFILKGEGKKALILLHGLTGSPFELRWIGGKFNQEGYDVYCPILPGHCTTVKDLE
KTKWKDWLEAPRTLLKTIEKDYDEIYLAGLCVGGMLALLLSRESDKVKAVASWSPLVYLD
GWTIPKAVVFLPLVLSTPLKHIFYFKEKYPYGIKNDKVRKKVLSLAEKTSFVYDRFTGIV
LKELLDLSKYFVKQLPYIKKPTIIIHSKYDDVSSVKSAYTIYEKISSQKKKLIIVEDSYH
MITIDNDKETVFEQTLKFFQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagctataaagatggatttatcttaaaaggtgaaggtaagaaagctttaattttactt
cacggacttactggaagcccttttgaattaaggtggataggaggaaaatttaatcaggaa
ggttatgacgtttactgtcctatccttcctggacattgtactactgtcaaagatttagaa
aaaaccaagtggaaagattggttagaagctccacgaacacttttaaaaacgatagaaaaa
gattatgatgaaatatatttagcaggtctttgtgtgggtggaatgttggctttacttcta
tctagggaaagtgataaagttaaagcagtagccagttggtcgccccttgtttaccttgat
gggtggacgataccaaaagcagtagtttttcttcccttagtattatcaacgcctttaaaa
cacattttttactttaaagaaaagtatccttatggaataaaaaatgacaaagtaagaaaa
aaagttttaagtcttgcagaaaagacttcttttgtgtacgatagatttacaggcattgtt
ttgaaagaacttttagacttatctaagtatttcgtaaaacaacttccttacattaaaaaa
cctacaattattattcattcaaagtatgacgacgtatccagtgtaaaaagtgcctataca
atttatgaaaaaatctcttcacaaaagaaaaagcttataatagtagaagacagctaccac
atgataacaatagacaacgataaagaaacagtttttgaacaaacactaaaattctttcag
tga

DBGET integrated database retrieval system