KEGG   Sulfurihydrogenibium azorense: SULAZ_0787Help
Entry
SULAZ_0787        CDS       T00876                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:saf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SULAZ_0787
  Amino acid metabolism
   00300 Lysine biosynthesis
    SULAZ_0787
Enzymes [BR:saf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SULAZ_0787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
711693..712748
Genome map
AA seq 351 aa AA seqDB search
MKEKVIKYTIDLVNIPSVIGNEKEIADFVESFLKKILKNIIRYNNSIIAYNDLDPNKKTI
TLLGHLDTVPGINEFTGKVIDGKIYGLGASDMKGGLAVMMALAELFSKTESRYNLIYVFY
EKEEGPYETNGLEPLLKNYNIVQQSDLAFALEPTNNKIQMGCLGTMHAWVKFKGKRAHSA
RPWEGENAIHKAYKLLEKLYNFGRKEYDFEGLKYFEVLNATMVEYSGGRNIIPDEFKINL
NYRFAPGKTIDQAKKELIDFVEGQAEVEFTDVSPAGKVCKDNPILKEMISKYNLEVEAKQ
AWTDVGRLSMYGIDAVNFGPGDTAQAHQKNEYIPIENLEKNFEIFSNFLSC
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaaagtcataaaatataccatagaccttgttaacattccgtctgtaataggt
aatgaaaaagagatagcagactttgtagaaagttttttgaaaaaaattttgaaaaacatc
ataagatacaacaactctataattgcctacaacgatttagaccctaacaaaaaaactata
actctactgggacatttagatacagtccctggaataaacgagtttacaggtaaggttatt
gacggcaagatatacggacttggtgcaagtgatatgaaaggtggccttgctgttatgatg
gcactggctgaacttttctcaaaaacagagagtagatataaccttatatacgtgttttac
gaaaaagaagaaggcccctacgagacaaacggtttagaaccacttttaaagaattataac
attgttcaacaatctgaccttgcctttgccttagaacctacaaacaataagatacagatg
ggttgccttggtacaatgcacgcttgggttaagtttaaaggaaagagggcacactctgca
agaccttgggaaggggaaaacgcaatacacaaagcttataaacttttagaaaaactgtat
aactttggtagaaaagagtatgattttgaaggtttaaaatactttgaagttttaaacgca
acgatggttgagtatagtggtggtaggaacattattcctgatgagtttaaaataaatcta
aactacaggtttgctccgggaaaaacaatagatcaagcaaaaaaagaacttatagacttt
gtagaaggtcaggcagaagtagagtttacagatgtatctccagcaggaaaagtctgtaaa
gacaaccctattttaaaagagatgataagtaagtacaatttagaagtagaggcaaaacag
gcttggactgacgttggaagattaagcatgtatgggatagacgctgtaaactttggtcct
ggagacacagcccaagcacaccaaaagaatgagtatatccccattgaaaatcttgagaaa
aactttgaaatcttctctaactttttgtcatgttaa

DBGET integrated database retrieval system