KEGG   Sulfurihydrogenibium azorense: SULAZ_0817Help
Entry
SULAZ_0817        CDS       T00876                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (UDP-MurNAc-L-Ala-D-Glu:meso-diaminopimelate ligase)(Meso-diaminopimelate-adding enzyme) (Meso-A2pm-adding enzyme) (UDP-N-acetylmuramyl-tripeptide synthetase) (UDP-MurNAc-tripeptidesynt (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:saf00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SULAZ_0817
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SULAZ_0817
Enzymes [BR:saf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     SULAZ_0817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
742857..744329
Genome map
AA seq 490 aa AA seqDB search
MKELQDLLTGEKVVNLGKSQVVKGITNNSSKVQKDYAFFAIKGNSTDGHHFIEDAITKGA
STVFIQDTSIIDTLKRKYPYINIVFSENTRKSLATASNKFYNEPSKYLKVIGITGTNGKT
SVSNLLAQYYENAGYKVGVIGTINYRIGDEILSSGHTTPDPVQWFETLNLMKEKGCDVVV
AEVSSHAAHQFRVYSTLFHGGIFTNLTQDHLDYHGTMENYFLAKREFFNQIQLFNDKAIA
SVNIDDPYGKRIYNDFKEKIDFITYGFEGEFKIKDYNLSLFETLFNIEYKGKTLNFKTKL
RGLFNVYNLSASISFLIKDGFDIDFLKDKTLDLKPIRGRFEVVEAKDFIVVIDYAHTPDA
LENILKSLNQIKQNRVITVFGAGGNRDRTKRPLMGKVAQDFSDIVILTSDNPRFEDPNQI
IKDILEGITQKSKVIVEPDRKKAIEYAIKTAQKGDIVLIAGKGHENYQIIKDQVIPFDDK
EVVNQILKEI
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagcttcaagacttacttacaggcgagaaagtagtaaatttaggaaaaagtcaa
gttgtaaaaggtataacaaataacagtagtaaagtacaaaaagattacgccttttttgct
ataaaagggaattctacagatgggcatcactttatagaagacgctataactaaaggtgca
agtactgtttttattcaagatacatcaatcattgatacattgaaaagaaaatatccctac
ataaatatagtcttttcagaaaatacgagaaaaagtcttgctacagcttcaaacaaattt
tacaatgaaccttcaaagtacttaaaagttataggcattactggaacaaacgggaaaact
tcagtctctaacctacttgcccagtactacgaaaatgcaggatacaaagtaggagtaata
ggaactataaactaccgtataggagatgaaattttatcgtcagggcacacaaccccagac
cctgtccaatggtttgaaaccctcaaccttatgaaagaaaaagggtgtgatgtagtggtt
gcagaagtctcttcccatgcagctcaccagtttagagtttactcaaccctattccacgga
ggcatctttacaaacctaactcaagaccacttagactatcacggaactatggaaaactac
tttttagcaaaaagagagtttttcaaccagatacaacttttcaacgataaagctatagca
agtgtaaacatagatgacccttacggaaaaagaatatacaacgactttaaagaaaagata
gactttataacatacggatttgagggagaatttaagataaaagactacaacctgtccctt
tttgaaacactgtttaatatagaatataaaggaaagactttaaactttaaaacaaaactc
agaggactgtttaacgtttacaacctttcagcttctatatcttttttaatcaaagatgga
tttgatatagactttctaaaagataagactttagacctaaaaccaattagaggtaggttt
gaggttgtagaggcaaaagattttatagttgtaatagactatgcccatacaccagatgca
cttgaaaatattttaaaatctctaaaccagataaaacaaaatagagtaatcacagtcttt
ggagccggaggtaatagagataggactaaaagaccattaatgggaaaagttgcacaagat
ttttctgacatagttatactaacatcagacaacccaagatttgaagacccaaaccaaata
ataaaggatatattagaaggcataacccaaaagtctaaagttatagtagagccagataga
aaaaaagctatagagtatgccataaaaacggctcaaaaaggagatatagtactaatagcc
gggaaaggacacgaaaactaccaaataatcaaggaccaagtcataccctttgatgacaaa
gaagtagttaatcagatacttaaggagatttaa

DBGET integrated database retrieval system