KEGG   Sulfurihydrogenibium azorense: SULAZ_0850Help
Entry
SULAZ_0850        CDS       T00876                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:saf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SULAZ_0850 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SULAZ_0850 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SULAZ_0850 (trpB)
Enzymes [BR:saf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SULAZ_0850 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(774521..775768)
Genome map
AA seq 415 aa AA seqDB search
MKKYTFPDERGYYGQFGGKYLPETLIPALEELEQQYLKIKNDGDFKRQLLYYLTEYAGRP
TPLYFASRLTQVVGGAKIYLKREDLLHTGAHKINNTLGQVLLTKRLGKKRIIAETGAGQH
GVSTATAAALFGLECTIYMGEEDAERQALNVFRMKLLGAKVEIVKSGSRTLKDAVNEALR
DWVTNVRTTHYIIGSALGPHPFPMIVRDFQSVIGEEVKNQILEIEGKLPDVIVACVGGGS
NAIGIFYPFIEDEEVKLVGVEAGGYGLETGMHAASIVGGSVGVLHGMKSYFLQDQWGQIE
TTHSISAGLDYPGVGPEHAYLKESGRATYITATDEEALEGFLLLSRTEGIIPALESSHAV
IKAVEIAKNLDKHQSVVINLSGRGDKDVQSVKNLLDTDKELYERLLNKLKEKYGV
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatacacattccccgatgaaagaggatactacggacagtttggaggaaagtat
ttaccagagactttaatcccagctttagaagagttagagcagcagtatttaaagataaaa
aacgacggagactttaaaagacagctactttattacctaacagagtatgcaggaagacct
acaccactttactttgcttcaagacttacacaagtagtaggtggagctaaaatatactta
aaaagagaggatttactccatacaggagctcataagattaacaacactttaggtcaagtt
ttacttacaaaaagattaggtaaaaagagaataatagcagaaacaggagcaggacagcac
ggagtatcaacagcaacagctgcagctctatttggacttgagtgtacaatctacatggga
gaagaagatgcagaaagacaagctctaaatgtctttagaatgaaacttcttggagctaaa
gtagagatagtaaaatccggaagtagaactttaaaagacgcagttaacgaagctttaaga
gactgggttacaaacgtaaggacaacccactacataataggatcagctttgggacctcat
ccatttcctatgattgtgagggactttcagtcagttattggagaagaagtaaaaaatcag
atacttgagatagaaggaaaacttccagatgtaatagtcgcctgtgtaggtggtggaagt
aatgcaattggtatattctacccgtttatagaagatgaagaagttaagttagtaggagta
gaggccggaggatacggacttgagactggaatgcatgctgcaagtatagttggagggtct
gtaggtgttttacacggtatgaaatcttactttttacaagaccagtggggacagatagaa
acaactcactcaatatctgctggattagactatccgggtgtaggaccagaacatgcttac
ttaaaagaatctggaagagctacctacataacagctactgacgaagaggcgttagaagga
tttttactactatcaagaacagaaggtataataccagctttagagagctcccacgcagtt
ataaaagctgtagaaattgcaaaaaacttagacaaacaccaatcagtcgttatcaaccta
tctggaagaggagacaaggacgttcaatcagtaaaaaatcttttagacactgataaagag
ctttacgagagacttttaaataaactaaaggaaaagtacggagtataa

DBGET integrated database retrieval system