KEGG   Sulfurihydrogenibium azorense: SULAZ_0890Help
Entry
SULAZ_0890        CDS       T00876                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:saf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SULAZ_0890
   01230 Biosynthesis of amino acids
    SULAZ_0890
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SULAZ_0890
   00030 Pentose phosphate pathway
    SULAZ_0890
   00051 Fructose and mannose metabolism
    SULAZ_0890
   00052 Galactose metabolism
    SULAZ_0890
  Energy metabolism
   00680 Methane metabolism
    SULAZ_0890
Enzymes [BR:saf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SULAZ_0890
Protein phosphatases and associated proteins [BR:saf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SULAZ_0890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(814413..815408)
Genome map
AA seq 331 aa AA seqDB search
MLYAKVIMKRIGVLTSGGDCPGLNACIRAVVRTASYYNIEVIGFMRGFKGLIDNDYKVLD
YKSVAGILQRGGTILLTAREPRFKEYSYRKKAFENIKNLGIDALFVIGGNGSFQGAYLLH
KDFDLNVIGIPKTIDNDIYGTEYAIGFDTAVNNAMEAIDKIKDTTMSHERVFIVEVMGRD
SGFIALEVGMATGAEITLIPEYPLPIHVIEEKILKAKEMGKGFAIIVLAEGVASAKELAE
ILNQRLKDKSIGEIRYQVLGYIQRGGSPSAYDRIMASKFGVFAVEKYMEGNKNFMVAYED
GQLKIKPLEISFGKIRIPNIQEYEINNILSL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
ttgctatatgcaaaagtaataatgaaaagaattggagtgcttacaagcggcggagactgt
cctgggcttaatgcctgtattagggcagttgtccggactgcaagctactataacatcgaa
gttatagggtttatgagaggatttaaaggtttaatagataatgactacaaagtgttagat
tataaaagtgttgctgggatacttcaaagaggtggaactatactacttacagccagagag
ccaagatttaaagagtacagctacaggaaaaaagcctttgagaacataaaaaatttaggt
atagacgctttgtttgtgataggtggaaacggtagtttccaaggtgcataccttttacat
aaggactttgatttaaacgttataggaattccaaaaacaatcgataacgatatatacggt
actgagtatgcaataggttttgacacagctgttaacaacgcaatggaagctatagacaaa
ataaaagatacaacaatgtcccatgaaagggtttttattgtagaagtaatgggaagagac
agtggatttatagcactggaagttggaatggctacaggagctgaaataacacttatacca
gagtatcctcttccaattcacgtgatagaagaaaagattttaaaagcaaaggagatggga
aaaggatttgctatcattgttttggcagaaggtgttgcgtcagcaaaggaacttgcagaa
atactaaatcaaaggttaaaagataaatctataggagagataagatatcaagttttagga
tatattcaaagaggaggaagtccgtcagcttacgataggattatggcttctaaatttggc
gtttttgcagtagaaaagtacatggaagggaataaaaactttatggtagcttacgaagac
ggtcaattaaaaataaaacctcttgaaatttcttttggaaaaataaggatacctaacatt
caagagtacgaaataaacaacattctctcactatga

DBGET integrated database retrieval system