KEGG   Sulfurihydrogenibium azorense: SULAZ_1176Help
Entry
SULAZ_1176        CDS       T00876                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:saf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SULAZ_1176 (galU)
   00052 Galactose metabolism
    SULAZ_1176 (galU)
   00500 Starch and sucrose metabolism
    SULAZ_1176 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SULAZ_1176 (galU)
Enzymes [BR:saf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SULAZ_1176 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1087467..1088357
Genome map
AA seq 296 aa AA seqDB search
MKKIRKAVIPVAGFGTRFLPATKSTPKEMMPLIDKPIIHYIVEEAVNSGIETIIFVTGRH
KRAIEDYFDYYPELEQVLKKAGKEKEIEKLRQISNMAEFVYIRQKEQLGLGHAVLTAERL
VGDEPFVVLLGDEIIKNDENPGIKQLIDIYYQFGKSVIGTMEVQKEDVSKYGIVAGKEVI
NGIKLVETLVEKPAIEEAPSTSAIIGRYVLTPNIFESLKQTTIGKGGELQLTDGLINLRK
KEVIYAKDIEGIRHDTGNKIGYLEAILDYALEREDVKEEFIKMLKEKCKEVEQGQS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattaggaaagcagttatcccagtagctggctttggaacaagatttttacct
gctacaaagtccacacctaaagagatgatgccacttatagacaagcctatcattcactac
atagttgaagaagctgtaaattctggaatagaaaccataatattcgtgactggaagacat
aaaagagctattgaagactattttgactactatccggaactcgaacaagttttaaagaaa
gcaggtaaagagaaagagatagaaaaattgagacagataagtaatatggctgaatttgtt
tatatacgtcaaaaagaacagctaggcctaggacatgcagttttaactgctgaaagactt
gtgggagatgagccttttgtagtccttttaggtgatgagattataaaaaacgatgaaaac
ccagggataaaacagcttatagatatatactatcaatttggaaaatccgttattggtact
atggaagtacaaaaggaagacgttagtaaatatggaattgttgcaggaaaagaagtgatt
aacggtataaagttagtagaaacgcttgtagaaaaaccagctattgaagaagcaccatct
acttcagcaatcataggtagatacgtacttacacctaacatttttgaatctttaaaacaa
actactataggtaaaggtggagagctgcagcttacagacggacttattaatttaaggaaa
aaagaagttatatacgcaaaagatatagaaggaataagacatgacacaggtaataaaata
ggctatttagaagctatattagattacgcattagaaagagaagatgtaaaagaagaattt
attaaaatgttaaaggaaaagtgtaaagaagttgaacaaggtcaaagctaa

DBGET integrated database retrieval system