KEGG   Sulfurihydrogenibium azorense: SULAZ_1260Help
Entry
SULAZ_1260        CDS       T00876                                 

Definition
(GenBank) N-acetyl-D-glucosamine kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
saf00010  Glycolysis / Gluconeogenesis
saf00052  Galactose metabolism
saf00500  Starch and sucrose metabolism
saf00520  Amino sugar and nucleotide sugar metabolism
saf00521  Streptomycin biosynthesis
saf01100  Metabolic pathways
saf01110  Biosynthesis of secondary metabolites
saf01120  Microbial metabolism in diverse environments
saf01130  Biosynthesis of antibiotics
saf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:saf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SULAZ_1260
   00052 Galactose metabolism
    SULAZ_1260
   00500 Starch and sucrose metabolism
    SULAZ_1260
   00520 Amino sugar and nucleotide sugar metabolism
    SULAZ_1260
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SULAZ_1260
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SULAZ_1260
Enzymes [BR:saf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SULAZ_1260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ACN98881
UniProt: C1DVU2
Position
1175501..1176385
Genome map
AA seq 294 aa AA seqDB search
MSRFLGVDIGGTFLKVAFKEDDEIKTEKVAVKDIQKKDYFLRSLSQVIKKYNPHRIGIAI
AGLVDKKTGLLTNSPNLKFLEGLNLKEFIEREFNVEVFVENDANVAAYGEYVYGNGKDSK
VLVCLTLGTGLGGGLVIDGKIFSGVSGSAMEIGHITIEKDGFLCHCGRKGCLESYVSSYG
LERLYCLISEDRKTSFDIINLAKQNDEKAVQTFEVFTDYLAIGIMSIAHIFNPDTVLLAG
GIIENYPMVLTLTKSKVEKLVFPLPLRDLHIDTAKLGSWSGAYGALALAEIYSS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagtagatttttaggtgtagatattggtgggactttcttaaaggttgccttcaaagaa
gatgatgagattaaaacagaaaaagtagcagttaaagacattcaaaaaaaagattatttt
ttaaggagtttaagccaagtcataaagaagtacaatccccatagaataggaatcgctata
gctggtcttgttgataaaaaaacaggtcttttaacaaactctccaaaccttaaattttta
gaagggctaaaccttaaagagtttatagaaagagagtttaacgttgaagtatttgtagaa
aacgatgcaaatgttgcagcttatggagagtatgtatacggcaacggtaaagacagtaaa
gttttagtttgtctaacattgggtactggtcttggtggtggattagtgatagatggaaag
attttttctggtgtatcaggaagtgctatggagataggtcatataactattgaaaaagat
gggtttttatgccactgtggaagaaaaggttgtctggagagttatgtatcttcttacgga
cttgaaagactttactgtcttatctcagaagatagaaaaacctcttttgatataataaac
cttgcaaagcaaaatgatgagaaagctgttcaaacttttgaagtttttacagactacctt
gcaataggaataatgagtattgcccacatatttaatccggacacagttttactcgcaggt
ggaattattgaaaactatccaatggttttaactcttactaaaagtaaagttgaaaagctt
gtgtttcctcttccacttagagatttacatattgatactgcaaaacttggaagttggagt
ggtgcttacggagctctcgcactggcagaaatttactcttcatag

DBGET integrated database retrieval system