KEGG   Sulfurihydrogenibium azorense: SULAZ_1260Help
Entry
SULAZ_1260        CDS       T00876                                 

Definition
N-acetyl-D-glucosamine kinase (EC:2.7.1.59)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:saf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SULAZ_1260
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SULAZ_1260
   00052 Galactose metabolism
    SULAZ_1260
   00500 Starch and sucrose metabolism
    SULAZ_1260
   00520 Amino sugar and nucleotide sugar metabolism
    SULAZ_1260
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SULAZ_1260
   00524 Butirosin and neomycin biosynthesis
    SULAZ_1260
Enzymes [BR:saf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SULAZ_1260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1175501..1176385
Genome map
AA seq 294 aa AA seqDB search
MSRFLGVDIGGTFLKVAFKEDDEIKTEKVAVKDIQKKDYFLRSLSQVIKKYNPHRIGIAI
AGLVDKKTGLLTNSPNLKFLEGLNLKEFIEREFNVEVFVENDANVAAYGEYVYGNGKDSK
VLVCLTLGTGLGGGLVIDGKIFSGVSGSAMEIGHITIEKDGFLCHCGRKGCLESYVSSYG
LERLYCLISEDRKTSFDIINLAKQNDEKAVQTFEVFTDYLAIGIMSIAHIFNPDTVLLAG
GIIENYPMVLTLTKSKVEKLVFPLPLRDLHIDTAKLGSWSGAYGALALAEIYSS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagtagatttttaggtgtagatattggtgggactttcttaaaggttgccttcaaagaa
gatgatgagattaaaacagaaaaagtagcagttaaagacattcaaaaaaaagattatttt
ttaaggagtttaagccaagtcataaagaagtacaatccccatagaataggaatcgctata
gctggtcttgttgataaaaaaacaggtcttttaacaaactctccaaaccttaaattttta
gaagggctaaaccttaaagagtttatagaaagagagtttaacgttgaagtatttgtagaa
aacgatgcaaatgttgcagcttatggagagtatgtatacggcaacggtaaagacagtaaa
gttttagtttgtctaacattgggtactggtcttggtggtggattagtgatagatggaaag
attttttctggtgtatcaggaagtgctatggagataggtcatataactattgaaaaagat
gggtttttatgccactgtggaagaaaaggttgtctggagagttatgtatcttcttacgga
cttgaaagactttactgtcttatctcagaagatagaaaaacctcttttgatataataaac
cttgcaaagcaaaatgatgagaaagctgttcaaacttttgaagtttttacagactacctt
gcaataggaataatgagtattgcccacatatttaatccggacacagttttactcgcaggt
ggaattattgaaaactatccaatggttttaactcttactaaaagtaaagttgaaaagctt
gtgtttcctcttccacttagagatttacatattgatactgcaaaacttggaagttggagt
ggtgcttacggagctctcgcactggcagaaatttactcttcatag

DBGET integrated database retrieval system