KEGG   Sulfurihydrogenibium azorense: SULAZ_1260Help
Entry
SULAZ_1260        CDS       T00876                                 

Definition
N-acetyl-D-glucosamine kinase (EC:2.7.1.59)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:saf01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:saf00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:saf00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:saf00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:saf00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:saf00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1175501..1176385
Genome map
AA seq 294 aa AA seqDB search
MSRFLGVDIGGTFLKVAFKEDDEIKTEKVAVKDIQKKDYFLRSLSQVIKKYNPHRIGIAI
AGLVDKKTGLLTNSPNLKFLEGLNLKEFIEREFNVEVFVENDANVAAYGEYVYGNGKDSK
VLVCLTLGTGLGGGLVIDGKIFSGVSGSAMEIGHITIEKDGFLCHCGRKGCLESYVSSYG
LERLYCLISEDRKTSFDIINLAKQNDEKAVQTFEVFTDYLAIGIMSIAHIFNPDTVLLAG
GIIENYPMVLTLTKSKVEKLVFPLPLRDLHIDTAKLGSWSGAYGALALAEIYSS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagtagatttttaggtgtagatattggtgggactttcttaaaggttgccttcaaagaa
gatgatgagattaaaacagaaaaagtagcagttaaagacattcaaaaaaaagattatttt
ttaaggagtttaagccaagtcataaagaagtacaatccccatagaataggaatcgctata
gctggtcttgttgataaaaaaacaggtcttttaacaaactctccaaaccttaaattttta
gaagggctaaaccttaaagagtttatagaaagagagtttaacgttgaagtatttgtagaa
aacgatgcaaatgttgcagcttatggagagtatgtatacggcaacggtaaagacagtaaa
gttttagtttgtctaacattgggtactggtcttggtggtggattagtgatagatggaaag
attttttctggtgtatcaggaagtgctatggagataggtcatataactattgaaaaagat
gggtttttatgccactgtggaagaaaaggttgtctggagagttatgtatcttcttacgga
cttgaaagactttactgtcttatctcagaagatagaaaaacctcttttgatataataaac
cttgcaaagcaaaatgatgagaaagctgttcaaacttttgaagtttttacagactacctt
gcaataggaataatgagtattgcccacatatttaatccggacacagttttactcgcaggt
ggaattattgaaaactatccaatggttttaactcttactaaaagtaaagttgaaaagctt
gtgtttcctcttccacttagagatttacatattgatactgcaaaacttggaagttggagt
ggtgcttacggagctctcgcactggcagaaatttactcttcatag

DBGET integrated database retrieval system