KEGG   Sulfurihydrogenibium azorense: SULAZ_1375Help
Entry
SULAZ_1375        CDS       T00876                                 

Definition
(GenBank) endoglucanase fragment
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
saf  Sulfurihydrogenibium azorense
Brite
Enzymes [BR:saf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SULAZ_1375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1280443..1281405)
Genome map
AA seq 320 aa AA seqDB search
MKRLLIIFSVLGFLGFSNGQEILTWQNYKNKYIPNGSYVIDPYNENRVTSESQGYGMILA
ILNDDKTTFDNLWQWTRKNLQREDYLFSWLWNDEVKDKNNATDGDFLIAYALLKAYEKWG
DKAYKDEGEKIFNSLKNLIVIVKDNKLKDNYLLLPATYGFSNEKYDIVIFPSYYITFILK
ELSYKDNLWKGVYNYTKNILFKTILSTNLKFNLIEKKLIPISPVNLDVYRVIPYTYMAKE
SLEDLKTSFSEVDSFFKAKGYIPFNYNLGSLQQEVSESPFCVYRFFYLLYNDEKYLERYK
VLKNNDKNNYFCDTFELFLD
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggttgttaataattttttcagtgcttggttttttaggcttttcaaatggacag
gagattctaacatggcagaactacaaaaacaagtatatacctaatggaagttatgtaata
gatccttacaatgaaaaccgggttacatctgaatctcaaggttacggtatgatactcgcc
attttaaacgatgataaaacaacttttgataacctttggcagtggactaggaaaaacctt
caaagagaagattatcttttctcatggctttggaatgatgaagtaaaagataaaaataac
gctacagatggagacttcttaattgcttatgcattgttgaaggcatacgaaaagtgggga
gataaggcatataaagatgaaggagagaaaattttcaattctttgaagaatttgatagtt
attgtaaaagataataagttgaaagataactacttacttttacctgctacttacggtttt
tctaacgaaaagtatgatatagttatatttccttcttattatataacttttatacttaaa
gaattgtcttacaaagataacctttggaagggagtgtataactatactaaaaacattttg
tttaaaaccatactatccacaaacttgaaattcaacttaatagagaaaaaacttattcct
ataagtcctgttaatcttgatgtttacagagttataccttatacatacatggctaaggag
agtctggaagacttaaaaacatctttctctgaagtagattctttttttaaagcaaaaggt
tatattccttttaactataacttgggaagtttacagcaagaagtaagtgaatcaccattt
tgtgtttatagatttttttatttactgtacaatgatgaaaaatatttagaaaggtataaa
gttttaaagaataacgataaaaataattatttttgtgatacttttgaactttttttggat
taa

DBGET integrated database retrieval system