KEGG   Sulfurihydrogenibium azorense: SULAZ_1375Help
Entry
SULAZ_1375        CDS       T00876                                 

Definition
endoglucanase fragment
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SULAZ_1375
Enzymes [BR:saf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SULAZ_1375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1280443..1281405)
Genome map
AA seq 320 aa AA seqDB search
MKRLLIIFSVLGFLGFSNGQEILTWQNYKNKYIPNGSYVIDPYNENRVTSESQGYGMILA
ILNDDKTTFDNLWQWTRKNLQREDYLFSWLWNDEVKDKNNATDGDFLIAYALLKAYEKWG
DKAYKDEGEKIFNSLKNLIVIVKDNKLKDNYLLLPATYGFSNEKYDIVIFPSYYITFILK
ELSYKDNLWKGVYNYTKNILFKTILSTNLKFNLIEKKLIPISPVNLDVYRVIPYTYMAKE
SLEDLKTSFSEVDSFFKAKGYIPFNYNLGSLQQEVSESPFCVYRFFYLLYNDEKYLERYK
VLKNNDKNNYFCDTFELFLD
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggttgttaataattttttcagtgcttggttttttaggcttttcaaatggacag
gagattctaacatggcagaactacaaaaacaagtatatacctaatggaagttatgtaata
gatccttacaatgaaaaccgggttacatctgaatctcaaggttacggtatgatactcgcc
attttaaacgatgataaaacaacttttgataacctttggcagtggactaggaaaaacctt
caaagagaagattatcttttctcatggctttggaatgatgaagtaaaagataaaaataac
gctacagatggagacttcttaattgcttatgcattgttgaaggcatacgaaaagtgggga
gataaggcatataaagatgaaggagagaaaattttcaattctttgaagaatttgatagtt
attgtaaaagataataagttgaaagataactacttacttttacctgctacttacggtttt
tctaacgaaaagtatgatatagttatatttccttcttattatataacttttatacttaaa
gaattgtcttacaaagataacctttggaagggagtgtataactatactaaaaacattttg
tttaaaaccatactatccacaaacttgaaattcaacttaatagagaaaaaacttattcct
ataagtcctgttaatcttgatgtttacagagttataccttatacatacatggctaaggag
agtctggaagacttaaaaacatctttctctgaagtagattctttttttaaagcaaaaggt
tatattccttttaactataacttgggaagtttacagcaagaagtaagtgaatcaccattt
tgtgtttatagatttttttatttactgtacaatgatgaaaaatatttagaaaggtataaa
gttttaaagaataacgataaaaataattatttttgtgatacttttgaactttttttggat
taa

DBGET integrated database retrieval system