KEGG   Sulfurihydrogenibium azorense: SULAZ_1421Help
Entry
SULAZ_1421        CDS       T00876                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
saf00330  Arginine and proline metabolism
saf00332  Carbapenem biosynthesis
saf01100  Metabolic pathways
saf01130  Biosynthesis of antibiotics
saf01230  Biosynthesis of amino acids
Module
saf_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:saf00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SULAZ_1421 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SULAZ_1421 (proB)
Enzymes [BR:saf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SULAZ_1421 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACN98293
UniProt: C1DWA1
Position
complement(1329959..1331062)
Genome map
AA seq 367 aa AA seqDB search
MEKNQLIKKAKRIVIKIGSQILEKNNDIDIDFITDIANQIKKYSDREFIIVSSGAVLAGV
KKLKLPSRPKTITEKQAIASVGQAYLMQIYDKVFSEKDLIIGQMLLTIEGLQERKRYLYA
KETLNKLLEYKVVPIINENDAIAVEEIVFGDNDYLSSHVSVLADADLLIIISTAGGLYTD
DPSNPDAQLIKEVVDVDSALNYAKSSKSTFGTGGMRSKLEAAKIATSHSIPVMIVPKSSD
IIDKVLTGQEVGTFIYPSKRKKMSGKKSWLALLSHPKGRIIVDKGAEKALKEGKSLLPSG
IKEVEGIFNPKDTVAIVSQDNIVIGKGIVNLSYKDLKKIKGLNTKEASKILGKDVEEVVH
RDNLVIY
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaatcagctcataaaaaaagcaaaaagaattgtcatcaaaataggttctcaa
atacttgaaaaaaacaacgatatagatatagatttcattacagacattgcaaaccagata
aaaaaatactctgatagagagtttattatagtctcttctggagctgttttagctggtgta
aaaaagctaaaattaccaagtagacctaaaaccattacagaaaaacaggctatagcaagt
gtaggacaggcataccttatgcaaatttacgacaaagtattttccgaaaaagatttaatt
ataggtcagatgctacttaccatagaaggacttcaagagaggaaaagatacctatatgca
aaagaaacgttaaataaattacttgaatataaagttgttcctatcataaatgaaaacgat
gcaatagccgtagaagagatagtatttggagataatgactacctttcttcccatgtttct
gtattggcagatgcagacttactaataataatttcaacagctggaggactatacacagac
gacccttcaaatcccgatgcacagcttataaaagaagtagttgatgtagattcggcacta
aactatgcaaaatcttcaaagtccacctttggaaccggtggaatgagaagtaagttagaa
gctgcaaagatagcaacatctcactcaattcctgtaatgattgtacctaaaagtagtgat
attatagacaaagttttaacagggcaagaagtaggaacctttatctacccctctaaaaga
aagaagatgtcaggtaaaaaaagctggcttgccctcttatctcaccccaaaggtaggata
atagtagataaaggagctgaaaaagccttaaaagaaggtaaaagtttacttccaagtggt
atcaaagaagtagaaggaatttttaatccaaaggatactgtagctattgtaagtcaagat
aatatcgttatagggaaaggaatagttaatttaagctataaagatttgaaaaagataaaa
ggcttaaatacaaaagaagcttctaaaatacttggaaaagatgttgaagaagttgttcat
agagataatttagttatttattga

DBGET integrated database retrieval system