KEGG   Sulfurihydrogenibium azorense: SULAZ_1446Help
Entry
SULAZ_1446        CDS       T00876                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
saf  Sulfurihydrogenibium azorense
Brite
Enzymes [BR:saf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SULAZ_1446
Secretion system [BR:saf02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SULAZ_1446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1352967..1353857
Genome map
AA seq 296 aa AA seqDB search
MKLKMFIAGLMFAGTTVFAAESCLGGGSSKVSAAQVEKALSGILGNAKVVSVSDSPISGL
YEVIIETGNKKVPIYVDCNLKYLVNGEIIDVNKKVSLTRERFQQLQSQANSEKEVKLAKL
LGKDKVEMLKKEGLIDLINFVDTKNLPKSNITYGNGNIVVYVFTDPQCPFCAKLHKEIEK
ILKDRKDVRFEMVLYPLPFHKHARGISENIECQKDNNSKQNILNKSFDSVAKGDESGLSS
IDKPCTAGRGIIDKNLQYAQSVSINGTPTIVFPNKGIAVSGAIPAETLNKLIDILK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaaaaatgtttatagctggattgatgtttgcaggaacaactgtttttgcagct
gaaagttgtcttggtggtggaagtagtaaagtaagtgctgctcaagtagaaaaagcatta
tccggaattttaggaaacgcaaaagttgtaagtgtgtccgattcgcctatatcaggactt
tacgaagttataatagaaacaggaaataaaaaagtacctatatacgttgattgtaattta
aagtacttagtaaacggtgaaattatagatgtaaacaaaaaagtaagtcttacaagagaa
agattccaacagctccaatctcaagccaactctgagaaagaggttaaattagcaaagctt
ttaggtaaagacaaagttgaaatgctgaaaaaagaaggattaatagaccttataaacttt
gttgacacaaaaaatttacctaaatctaacattacctacggtaatggtaatattgtagtc
tacgtatttacagacccacagtgtcctttctgtgcaaagctgcataaagagatagaaaaa
atcctaaaagatagaaaagatgttagatttgagatggtgctgtaccctctaccgttccat
aaacatgcaagaggtatatcagaaaatatagagtgtcaaaaagacaacaactctaaacaa
aacatacttaacaaatcttttgacagtgtagcaaaaggagatgaatcgggactgtcttct
atagataagccttgtacagctggtagaggaataatagataaaaatcttcagtacgctcaa
tcagtaagtataaatggaactcctacaatagttttcccaaataaaggtatcgcagtatcc
ggtgcaataccagccgaaactttaaacaaacttatagacattttaaagtga

DBGET integrated database retrieval system