KEGG   Sulfurihydrogenibium azorense: SULAZ_1524Help
Entry
SULAZ_1524        CDS       T00876                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:saf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SULAZ_1524 (tpiA)
   01230 Biosynthesis of amino acids
    SULAZ_1524 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SULAZ_1524 (tpiA)
   00051 Fructose and mannose metabolism
    SULAZ_1524 (tpiA)
   00562 Inositol phosphate metabolism
    SULAZ_1524 (tpiA)
Enzymes [BR:saf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SULAZ_1524 (tpiA)
Exosome [BR:saf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SULAZ_1524 (tpiA)
  Exosomal proteins of bladder cancer cells
   SULAZ_1524 (tpiA)
  Exosomal proteins of melanoma cells
   SULAZ_1524 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1420902..1421654)
Genome map
AA seq 250 aa AA seqDB search
MRYLIAANWKMNKTVAESIDYIEIFKDLVKEVEGVEIMIAPSFTALSSVSILLEKTNISL
GAQNMFYVERGAYTGEISPIMLTELNVKYVILGHSERRHIFGEKDELINKKVLTAVEFGL
RPILCVGETLEERELGKTMNVVERQIRAGIAGLEREISLIDIAYEPVWAIGTGVNATVEQ
AQEVHHFIRNLINDISKGNDKDTRILYGGSVNEKNASELIKAPDVEGFLVGTASLDPQKF
YKIILSSLEV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagatacttaatagcagcaaactggaagatgaacaaaactgtagcagaatctattgat
tatatagaaatatttaaagatcttgttaaagaggtggaaggagtagaaattatgatagct
ccttcctttacagctttatcttctgtttctattttacttgaaaaaacaaacattagttta
ggtgctcaaaatatgttttatgtagaaagaggagcttacactggtgagatatctcctatt
atgcttactgaacttaacgttaaatatgtgatacttggacattctgagagaagacatatc
tttggtgaaaaagatgaactaattaataaaaaagttttaactgctgtagagtttggttta
aggcctattctatgtgtaggagaaacattagaagaaagagagcttggcaaaactatgaat
gtagttgaaagacagataagagccggtattgcagggttagaaagagagataagccttata
gacattgcttacgaaccagtatgggcgataggaacaggagtaaatgcaactgtagaacaa
gctcaagaggtacatcattttattagaaatcttattaacgatataagtaaaggaaatgat
aaagatacgagaatactttatggtggtagtgtaaatgaaaaaaatgcttctgaattgata
aaagctcctgatgttgaaggatttttagttggaaccgcaagtcttgacccacaaaagttt
tataaaataattttatcttctttggaggtttaa

DBGET integrated database retrieval system