KEGG   Sulfurihydrogenibium azorense: SULAZ_1536Help
Entry
SULAZ_1536        CDS       T00876                                 

Gene name
acsA_2
Definition
(RefSeq) acetate--CoA ligase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:saf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SULAZ_1536 (acsA_2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SULAZ_1536 (acsA_2)
   00620 Pyruvate metabolism
    SULAZ_1536 (acsA_2)
   00640 Propanoate metabolism
    SULAZ_1536 (acsA_2)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SULAZ_1536 (acsA_2)
   00680 Methane metabolism
    SULAZ_1536 (acsA_2)
Enzymes [BR:saf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SULAZ_1536 (acsA_2)
Lipid biosynthesis proteins [BR:saf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SULAZ_1536 (acsA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1431356..1433254
Genome map
AA seq 632 aa AA seqDB search
MENLEQVHLQVKEIFYPPEDIKKECIVQDYESMYKKSIENPEEFWSEVASQLHWFQKWDK
VLEWNFPYAKWFVNGKTNITYNCLDANIEKGRRNKVAYISVDEEGNEKKLTYGELLEQVN
RLANGLKSLGVSKGDRVSIYMPNTVEAVISMLACARIGAIHSVVFAGFSEGALKLRINDA
KAKVVITATYTKRRGKKIPLLPIVKEAIYDLDFVKNVIVWDRDRELEESEFSKKFVSFEE
LIKTSSPYFNPEVMDSEDPLFILYTSGTTGKPKGVLHTVGGYMVNTYLTTKTVFNIKEDT
VYWCTADIGWITGHSYIVYGPLLNGTTIVMMEGVPVYPHPGIWWEYVDKYRVNVFYTAPT
AIRMLMRFGDEIPAKYDLSSLKILGSVGEPINPEAWLWYYKNIGRGKAVVVDTWWQTETG
AHMITTLPCYPAKPGKAGKPLFGVVPDIVDKEGNSLPPNTIGHLVIKKPWPSMLRTCWGE
PERYEKYWKEIPGNVYSAGDLATIDEDGYIMILGRADDVLSVAGHRIGNAEVESAIIEHP
AVAEAAVIGKPNEIKGESIKAFVVLKEGYTPSAELVEEIKETVKEVLGAIAVPDEIEFVD
KLPKTRSGKIMRRVLRAKELGQELGDISTLED
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatttagagcaagttcaccttcaggtaaaagaaattttctatccaccagaagat
attaaaaaagagtgtatcgttcaagattacgaaagtatgtataaaaaatctatagaaaac
ccagaagaattctggtcagaagttgcatcacagcttcactggtttcaaaagtgggacaag
gtcttagagtggaacttcccttatgcaaagtggtttgtaaatggaaaaacaaacataact
tataattgtttagatgctaacattgaaaaaggtagaagaaataaagtagcttacatatca
gtagatgaagaaggaaatgagaaaaaactcacttacggagaattactcgaacaagtaaac
agacttgcaaacggattaaagtcgttaggtgtatcaaaaggagatagggtctctatatat
atgccaaacacggtagaagctgtaatttctatgcttgcctgtgcaagaataggagctata
cacagtgtagttttcgctggatttagtgaaggagccttaaagttaagaataaacgacgca
aaggcaaaagttgttataactgcaacctacacaaagagaaggggcaaaaagattcctcta
cttccaattgtgaaagaagccatatatgacttagattttgtcaagaatgtaatagtttgg
gatagagatagagagttagaagaatctgagtttagtaagaagtttgtaagttttgaggag
ttgataaaaacatcttctccctacttcaatcctgaggttatggattcagaagaccctctg
tttatactttacacatcgggaacaacaggaaagccaaaaggtgtgctacacacagtcggt
ggatatatggtaaacacttacctaactactaaaacagtgtttaacataaaagaagatact
gtttactggtgtactgcagatataggctggataacaggtcatagctatatagtctatgga
ccacttttaaatgggacaactattgtaatgatggaaggagtgcctgtataccctcatcct
ggaatatggtgggagtatgtagacaaatacagagttaacgtattctacacagctcctaca
gctataaggatgcttatgagatttggagacgagatacctgcgaagtacgatttatcatct
ttaaaaattttagggtctgtaggagagccaataaatccagaagcttggctttggtactac
aaaaacataggtagaggaaaagctgtagttgtagatacttggtggcaaacagaaacagga
gctcatatgataactactttaccttgttatcctgcaaaaccaggaaaagcaggaaaacct
ctatttggtgttgttcctgacattgtagataaagaaggaaactcactgccacctaacacg
ataggacaccttgttataaagaagccttggccttctatgcttagaacttgttggggagag
cctgaaaggtatgaaaagtactggaaagaaatccccggaaacgtttactcagctggagac
cttgctacaatagatgaagatggttatataatgatacttggaagagctgatgatgtttta
agtgttgcaggacacagaataggtaatgcggaagttgagtcagctataatagaacatcca
gcagtagcagaagctgctgtaataggaaaaccaaacgagataaaaggagagtctataaaa
gcgtttgttgttttaaaagaaggttatactccttctgctgaacttgtagaagaaataaaa
gaaacagttaaagaagtacttggagctatagcagttccagacgagatagagtttgtagat
aaactaccaaagacaagaagcggcaaaataatgagaagagtgttaagagccaaagagtta
ggacaagaacttggagacatctcaactttagaagattaa

DBGET integrated database retrieval system