KEGG   Sulfurihydrogenibium azorense: SULAZ_1536Help
Entry
SULAZ_1536        CDS       T00876                                 

Gene name
acsA_2
Definition
acetate--CoA ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:saf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SULAZ_1536 (acsA_2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SULAZ_1536 (acsA_2)
   00620 Pyruvate metabolism
    SULAZ_1536 (acsA_2)
   00640 Propanoate metabolism
    SULAZ_1536 (acsA_2)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SULAZ_1536 (acsA_2)
   00680 Methane metabolism
    SULAZ_1536 (acsA_2)
Enzymes [BR:saf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SULAZ_1536 (acsA_2)
Lipid biosynthesis proteins [BR:saf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SULAZ_1536 (acsA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1431356..1433254
Genome map
AA seq 632 aa AA seqDB search
MENLEQVHLQVKEIFYPPEDIKKECIVQDYESMYKKSIENPEEFWSEVASQLHWFQKWDK
VLEWNFPYAKWFVNGKTNITYNCLDANIEKGRRNKVAYISVDEEGNEKKLTYGELLEQVN
RLANGLKSLGVSKGDRVSIYMPNTVEAVISMLACARIGAIHSVVFAGFSEGALKLRINDA
KAKVVITATYTKRRGKKIPLLPIVKEAIYDLDFVKNVIVWDRDRELEESEFSKKFVSFEE
LIKTSSPYFNPEVMDSEDPLFILYTSGTTGKPKGVLHTVGGYMVNTYLTTKTVFNIKEDT
VYWCTADIGWITGHSYIVYGPLLNGTTIVMMEGVPVYPHPGIWWEYVDKYRVNVFYTAPT
AIRMLMRFGDEIPAKYDLSSLKILGSVGEPINPEAWLWYYKNIGRGKAVVVDTWWQTETG
AHMITTLPCYPAKPGKAGKPLFGVVPDIVDKEGNSLPPNTIGHLVIKKPWPSMLRTCWGE
PERYEKYWKEIPGNVYSAGDLATIDEDGYIMILGRADDVLSVAGHRIGNAEVESAIIEHP
AVAEAAVIGKPNEIKGESIKAFVVLKEGYTPSAELVEEIKETVKEVLGAIAVPDEIEFVD
KLPKTRSGKIMRRVLRAKELGQELGDISTLED
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatttagagcaagttcaccttcaggtaaaagaaattttctatccaccagaagat
attaaaaaagagtgtatcgttcaagattacgaaagtatgtataaaaaatctatagaaaac
ccagaagaattctggtcagaagttgcatcacagcttcactggtttcaaaagtgggacaag
gtcttagagtggaacttcccttatgcaaagtggtttgtaaatggaaaaacaaacataact
tataattgtttagatgctaacattgaaaaaggtagaagaaataaagtagcttacatatca
gtagatgaagaaggaaatgagaaaaaactcacttacggagaattactcgaacaagtaaac
agacttgcaaacggattaaagtcgttaggtgtatcaaaaggagatagggtctctatatat
atgccaaacacggtagaagctgtaatttctatgcttgcctgtgcaagaataggagctata
cacagtgtagttttcgctggatttagtgaaggagccttaaagttaagaataaacgacgca
aaggcaaaagttgttataactgcaacctacacaaagagaaggggcaaaaagattcctcta
cttccaattgtgaaagaagccatatatgacttagattttgtcaagaatgtaatagtttgg
gatagagatagagagttagaagaatctgagtttagtaagaagtttgtaagttttgaggag
ttgataaaaacatcttctccctacttcaatcctgaggttatggattcagaagaccctctg
tttatactttacacatcgggaacaacaggaaagccaaaaggtgtgctacacacagtcggt
ggatatatggtaaacacttacctaactactaaaacagtgtttaacataaaagaagatact
gtttactggtgtactgcagatataggctggataacaggtcatagctatatagtctatgga
ccacttttaaatgggacaactattgtaatgatggaaggagtgcctgtataccctcatcct
ggaatatggtgggagtatgtagacaaatacagagttaacgtattctacacagctcctaca
gctataaggatgcttatgagatttggagacgagatacctgcgaagtacgatttatcatct
ttaaaaattttagggtctgtaggagagccaataaatccagaagcttggctttggtactac
aaaaacataggtagaggaaaagctgtagttgtagatacttggtggcaaacagaaacagga
gctcatatgataactactttaccttgttatcctgcaaaaccaggaaaagcaggaaaacct
ctatttggtgttgttcctgacattgtagataaagaaggaaactcactgccacctaacacg
ataggacaccttgttataaagaagccttggccttctatgcttagaacttgttggggagag
cctgaaaggtatgaaaagtactggaaagaaatccccggaaacgtttactcagctggagac
cttgctacaatagatgaagatggttatataatgatacttggaagagctgatgatgtttta
agtgttgcaggacacagaataggtaatgcggaagttgagtcagctataatagaacatcca
gcagtagcagaagctgctgtaataggaaaaccaaacgagataaaaggagagtctataaaa
gcgtttgttgttttaaaagaaggttatactccttctgctgaacttgtagaagaaataaaa
gaaacagttaaagaagtacttggagctatagcagttccagacgagatagagtttgtagat
aaactaccaaagacaagaagcggcaaaataatgagaagagtgttaagagccaaagagtta
ggacaagaacttggagacatctcaactttagaagattaa

DBGET integrated database retrieval system