KEGG   Sulfurihydrogenibium azorense: SULAZ_1669Help
Entry
SULAZ_1669        CDS       T00876                                 

Gene name
thrC_2
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:saf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SULAZ_1669 (thrC_2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SULAZ_1669 (thrC_2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SULAZ_1669 (thrC_2)
Enzymes [BR:saf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SULAZ_1669 (thrC_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1555945..1557015
Genome map
AA seq 356 aa AA seqDB search
MGCKWKGIIEAYREYLPVSDKTPIITLHEGNTPLIKADNLSKEIAPDKNLTIYLKYEGLN
PTGSFKDRGMTMAISKAKESGKEAVICASTGNTSASAAAYAARAGMRAYVLLPKGAVAIG
KLSQAMVYGAKIIAVMGNFDDALEIVREIGEKYPVEVVNSVNPYRLEGQKTAAFEVCDYL
EEAPDFHFLPVGNAGNITAYWKGYKEYYQLGKVKKTPRMIGWQAEGAAPIVKGFPIKNPQ
TIATAIRIGNPYSWQPALQAAKESNGFIDAVSDEEILQAYKLVASTEGVFCEPASAASIA
GVIKAYKKGVFKGGETIVCTLTGNGLKDPDTVIKASEKPVELPPDLDEIAKFLELK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgggctgtaaatggaaaggaataattgaagcttacagagaatacttaccagtaagtgat
aaaacaccgattataactctccacgaagggaacacaccccttataaaagcagataacctg
tcaaaagagatagcccctgataaaaatcttacaatctatttaaagtatgaaggattaaac
cctacagggtctttcaaagaccgtggtatgactatggctatatcaaaagcaaaggaatca
ggtaaagaagctgtaatatgtgcatcaacaggaaatacttcagcgtctgcagctgcctat
gcagcaagagctggaatgagagcctacgtcttacttcccaaaggtgccgttgccatagga
aaactatctcaggctatggtctacggagctaaaattatagctgttatgggaaattttgat
gatgcacttgagattgttagagagataggagagaagtatcctgttgaagttgtaaactct
gttaacccttatagattagaaggtcaaaaaacggcagcctttgaagtatgtgactatctg
gaagaagctccggactttcactttttacctgtagggaatgcaggaaacatcacagcttac
tggaaaggctacaaagagtactatcaacttggtaaagtgaaaaaaacaccaaggatgata
ggatggcaagcagaaggagctgcacctatcgtaaaaggttttcctataaaaaatccacaa
acgatagcaacagcaataagaataggaaatccttacagctggcaaccagctttacaagca
gcaaaagaaagtaatggctttatagatgcagtatcagacgaagaaatactacaggcatac
aaattagtagcatcaacagaaggcgttttctgtgaacctgcttctgcagcttctattgca
ggagttataaaagcctataaaaaaggtgttttcaaaggtggagaaactattgtgtgtact
ttaacaggaaacggtttaaaagaccctgatactgtaatcaaagccagtgaaaagccagta
gaactaccaccagatttagatgaaatagcaaagtttttagagttaaaatga

DBGET integrated database retrieval system