KEGG   Sulfurihydrogenibium azorense: SULAZ_1669Help
Entry
SULAZ_1669        CDS       T00876                                 

Gene name
thrC_2
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
saf00260  Glycine, serine and threonine metabolism
saf00750  Vitamin B6 metabolism
saf01100  Metabolic pathways
saf01110  Biosynthesis of secondary metabolites
saf01120  Microbial metabolism in diverse environments
saf01230  Biosynthesis of amino acids
Module
saf_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:saf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SULAZ_1669 (thrC_2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SULAZ_1669 (thrC_2)
Enzymes [BR:saf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SULAZ_1669 (thrC_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACN99463
UniProt: C1DWZ0
Position
1555945..1557015
Genome map
AA seq 356 aa AA seqDB search
MGCKWKGIIEAYREYLPVSDKTPIITLHEGNTPLIKADNLSKEIAPDKNLTIYLKYEGLN
PTGSFKDRGMTMAISKAKESGKEAVICASTGNTSASAAAYAARAGMRAYVLLPKGAVAIG
KLSQAMVYGAKIIAVMGNFDDALEIVREIGEKYPVEVVNSVNPYRLEGQKTAAFEVCDYL
EEAPDFHFLPVGNAGNITAYWKGYKEYYQLGKVKKTPRMIGWQAEGAAPIVKGFPIKNPQ
TIATAIRIGNPYSWQPALQAAKESNGFIDAVSDEEILQAYKLVASTEGVFCEPASAASIA
GVIKAYKKGVFKGGETIVCTLTGNGLKDPDTVIKASEKPVELPPDLDEIAKFLELK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgggctgtaaatggaaaggaataattgaagcttacagagaatacttaccagtaagtgat
aaaacaccgattataactctccacgaagggaacacaccccttataaaagcagataacctg
tcaaaagagatagcccctgataaaaatcttacaatctatttaaagtatgaaggattaaac
cctacagggtctttcaaagaccgtggtatgactatggctatatcaaaagcaaaggaatca
ggtaaagaagctgtaatatgtgcatcaacaggaaatacttcagcgtctgcagctgcctat
gcagcaagagctggaatgagagcctacgtcttacttcccaaaggtgccgttgccatagga
aaactatctcaggctatggtctacggagctaaaattatagctgttatgggaaattttgat
gatgcacttgagattgttagagagataggagagaagtatcctgttgaagttgtaaactct
gttaacccttatagattagaaggtcaaaaaacggcagcctttgaagtatgtgactatctg
gaagaagctccggactttcactttttacctgtagggaatgcaggaaacatcacagcttac
tggaaaggctacaaagagtactatcaacttggtaaagtgaaaaaaacaccaaggatgata
ggatggcaagcagaaggagctgcacctatcgtaaaaggttttcctataaaaaatccacaa
acgatagcaacagcaataagaataggaaatccttacagctggcaaccagctttacaagca
gcaaaagaaagtaatggctttatagatgcagtatcagacgaagaaatactacaggcatac
aaattagtagcatcaacagaaggcgttttctgtgaacctgcttctgcagcttctattgca
ggagttataaaagcctataaaaaaggtgttttcaaaggtggagaaactattgtgtgtact
ttaacaggaaacggtttaaaagaccctgatactgtaatcaaagccagtgaaaagccagta
gaactaccaccagatttagatgaaatagcaaagtttttagagttaaaatga

DBGET integrated database retrieval system